![Western Blot: Fast skeletal myosin light chain 1 Antibody (2D9) [H00004632-M01] - Analysis of MYL1 expression in transfected 293T cell line by MYL1 monoclonal antibody (M01), clone 2D9.Lane 1: MYL1 transfected lysate(21.1 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/Fast-skeletal-myosin-light-chain-1-Antibody-2D9-Western-Blot-H00004632-M01-img0009.jpg "Western Blot: Fast skeletal myosin light chain 1 Antibody (2D9) [H00004632-M01] - Analysis of MYL1 expression in transfected 293T cell line by MYL1 monoclonal antibody (M01), clone 2D9.Lane 1: MYL1 transfected lysate(21.1 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, IHC, KD |
| Clone | 2D9 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | MYL1 (NP_524146, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNK |
| Specificity | MYL1 (2D9) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | MYL1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against recombinant protein for WB. It has been used for IHC-P, RNAi Validation and ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Fast skeletal myosin light chain 1 Antibody (H00004632-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Fast skeletal myosin light chain 1 Antibody (2D9) [H00004632-M01] - Analysis of monoclonal antibody to MYL1 on formalin-fixed paraffin-embedded human spleen. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize/Fast-skeletal-myosin-light-chain-1-Antibody-2D9-Immunohistochemistry-Paraffin-H00004632-M01-img0006.jpg "Immunohistochemistry-Paraffin: Fast skeletal myosin light chain 1 Antibody (2D9) [H00004632-M01] - Analysis of monoclonal antibody to MYL1 on formalin-fixed paraffin-embedded human spleen. Antibody concentration 3 ug/ml.")
![Western Blot: Fast skeletal myosin light chain 1 Antibody (2D9) [H00004632-M01] - Analysis of MYL1 over-expressed 293 cell line, cotransfected with MYL1 Validated Chimera RNAi ( Cat # H00004632-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with MYL1 monoclonal antibody (M01), clone 2D9 (Cat # H00004632-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.](http://images.novusbio.com/fullsize/Fast-skeletal-myosin-light-chain-1-Antibody-2D9-Western-Blot-H00004632-M01-img0007.jpg "Western Blot: Fast skeletal myosin light chain 1 Antibody (2D9) [H00004632-M01] - Analysis of MYL1 over-expressed 293 cell line, cotransfected with MYL1 Validated Chimera RNAi ( Cat # H00004632-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with MYL1 monoclonal antibody (M01), clone 2D9 (Cat # H00004632-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.")
![Sandwich ELISA: Fast skeletal myosin light chain 1 Antibody (2D9) [H00004632-M01] - Detection limit for recombinant GST tagged MYL1 is approximately 3ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/Fast-skeletal-myosin-light-chain-1-Antibody-2D9-Sandwich-ELISA-H00004632-M01-img0008.jpg "Sandwich ELISA: Fast skeletal myosin light chain 1 Antibody (2D9) [H00004632-M01] - Detection limit for recombinant GST tagged MYL1 is approximately 3ng/ml as a capture antibody.")
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22971.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22972.jpg)
![Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunocytochemistry_9890.jpg)
![Simple Western 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/1433_zeta_MAB2669_Simple_Western_16526.jpg)
![Western Blot 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/14-3-3_zeta_MAB2669_Western_Blot_12700.jpg)
![Immunohistochemistry 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/14-3-3_zeta_MAB2669_Immunohistochemistry_12730.jpg)
![SDS-PAGE GDF-8/Myostatin [Unconjugated]](https://images.novusbio.com/images2/GDF-8_788-G8_CF_114.jpg)
![Bioactivity GDF-8/Myostatin [Unconjugated]](https://images.novusbio.com/images2/GDF-8_788-G8_CF_116.jpg)
