![Western Blot: EYA2 Antibody [NBP1-84026] - Analysis in human cell line SCLC-21H.](http://images.novusbio.com/fullsize/EYA2-Antibody-Western-Blot-NBP1-84026-img0011.jpg "Western Blot: EYA2 Antibody [NBP1-84026] - Analysis in human cell line SCLC-21H.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GTTGFYQGGNGLGNAAGFGSVHQDYPSYPGFPQSQYPQYYGSSYNPPYVPASSICPSPLSTSTYVLQEASHNVPNQSSESLAGEYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | EYA2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for EYA2 Antibody (NBP1-84026)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | EYA2 |
![Immunohistochemistry-Paraffin: EYA2 Antibody [NBP1-84026] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/EYA2-Antibody-Immunohistochemistry-Paraffin-NBP1-84026-img0010.jpg "Immunohistochemistry-Paraffin: EYA2 Antibody [NBP1-84026] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.")
![Western Blot: EYA2 Antibody [NBP1-84026] - Analysis in human cell line SCLC-21H.](http://images.novusbio.com/fullsize/EYA2-Antibody-Western-Blot-NBP1-84026-img0006.jpg "Western Blot: EYA2 Antibody [NBP1-84026] - Analysis in human cell line SCLC-21H.")
![Immunohistochemistry-Paraffin: EYA2 Antibody [NBP1-84026] - Staining of human cervix, uterine shows strong nuclear positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/EYA2-Antibody-Immunohistochemistry-Paraffin-NBP1-84026-img0007.jpg "Immunohistochemistry-Paraffin: EYA2 Antibody [NBP1-84026] - Staining of human cervix, uterine shows strong nuclear positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: EYA2 Antibody [NBP1-84026] - Staining of human liver shows weak to moderate nuclear positivity in hepatocytes.](http://images.novusbio.com/fullsize/EYA2-Antibody-Immunohistochemistry-Paraffin-NBP1-84026-img0008.jpg "Immunohistochemistry-Paraffin: EYA2 Antibody [NBP1-84026] - Staining of human liver shows weak to moderate nuclear positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: EYA2 Antibody [NBP1-84026] - Staining of human stomach shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/EYA2-Antibody-Immunohistochemistry-Paraffin-NBP1-84026-img0009.jpg "Immunohistochemistry-Paraffin: EYA2 Antibody [NBP1-84026] - Staining of human stomach shows strong nuclear positivity in glandular cells.")
![Immunocytochemistry Pax3/Pax7 Antibody (274212) [Unconjugated]](https://images.novusbio.com/images2/Pax3_MAB2457_Immunocytochemistry__Immunofluorescence_20313.jpg)
![Immunocytochemistry/ Immunofluorescence Pax3/Pax7 Antibody (274212) [Unconjugated]](https://images.novusbio.com/images/mab2457_human-mouse-pax3-pax7-mab-clone-274212-41202412512639.jpg)
![Simple Western Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Simple_Western_17126.jpg)
![Immunocytochemistry Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Immunocytochemistry_14427.jpg)
![Western Blot Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Western_Blot_14743.jpg)
![Western Blot Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/Histone_H2AX_AF2288_Western_Blot_5182.jpg)
![Simple Western Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/16395.jpg)
![Immunocytochemistry Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/Histone_H2AX_AF2288_Immunocytochemistry__Immunofluorescence_16920.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")