![Western Blot: SIX4 Antibody (7E2) [H00051804-M09] - Immunoblots indicate miR-124-induced SIX4 depletion. siSIX4 is shown as an antibody control. Image collected and cropped by CiteAb from the following publication (//www.ncbi.nlm.nih.gov/pmc/articles/PMC4704493/) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/SIX4-Antibody-7E2-Western-Blot-H00051804-M09-img0007.jpg "Western Blot: SIX4 Antibody (7E2) [H00051804-M09] - Immunoblots indicate miR-124-induced SIX4 depletion. siSIX4 is shown as an antibody control. Image collected and cropped by CiteAb from the following publication (//www.ncbi.nlm.nih.gov/pmc/articles/PMC4704493/) licensed under a CC-BY license.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, KD |
| Clone | 7E2 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | SIX4 (NP_059116, 672 a.a. ~ 780 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GQDLLSVPMTQAALGEIVPTAEDQVGHPSPAVHQDFVQEHRLVLQSVANMKENFLSNSESKATSSLMMLDSKSKYVLDGMVDTVCEDLETDKKELAKLQTVQLDEDMQD |
| Specificity | SIX4 (7E2) |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | SIX4 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Publication using H00051804-M09 | Applications | Species |
|---|---|---|
| Shields BB, Pecot CV, Gao H et al. A genome-scale screen reveals context-dependent ovarian cancer sensitivity to miRNA overexpression. Mol. Syst. Biol. 2015-12-15 [PMID: 26655797] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: SIX homeobox 4 Antibody (7E2) [H00051804-M09] - Analysis of monoclonal antibody to SIX4 on HeLa cell. Antibody concentration 15 ug/ml](http://images.novusbio.com/fullsize/SIX-homeobox-4-Antibody-7E2-Immunocytochemistry-Immunofluorescence-H00051804-M09-img0004.jpg "Immunocytochemistry/Immunofluorescence: SIX homeobox 4 Antibody (7E2) [H00051804-M09] - Analysis of monoclonal antibody to SIX4 on HeLa cell. Antibody concentration 15 ug/ml")
![Western Blot: SIX homeobox 4 Antibody (7E2) [H00051804-M09] - Analysis of SIX4 expression in Hela S3 NE (Cat # L013V3).](http://images.novusbio.com/fullsize/SIX-homeobox-4-Antibody-7E2-Western-Blot-H00051804-M09-img0005.jpg "Western Blot: SIX homeobox 4 Antibody (7E2) [H00051804-M09] - Analysis of SIX4 expression in Hela S3 NE (Cat # L013V3).")
![ELISA: SIX homeobox 4 Antibody (7E2) [H00051804-M09] - Detection limit for recombinant GST tagged SIX4 is approximately 0.1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/SIX-homeobox-4-Antibody-7E2-ELISA-H00051804-M09-img0003.jpg "ELISA: SIX homeobox 4 Antibody (7E2) [H00051804-M09] - Detection limit for recombinant GST tagged SIX4 is approximately 0.1ng/ml as a capture antibody.")
![Knockdown Validated: SIX4 Antibody (7E2) [H00051804-M09] - Immunoblots indicate consequence of SIX4 depletion on LKB1 accumulation and AMPK pathway activation. Image collected and cropped by CiteAb from the following publication (//www.ncbi.nlm.nih.gov/pmc/articles/PMC4704493/) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/SIX4-Antibody-7E2-Knockdown-Validated-H00051804-M09-img0006.jpg "Knockdown Validated: SIX4 Antibody (7E2) [H00051804-M09] - Immunoblots indicate consequence of SIX4 depletion on LKB1 accumulation and AMPK pathway activation. Image collected and cropped by CiteAb from the following publication (//www.ncbi.nlm.nih.gov/pmc/articles/PMC4704493/) licensed under a CC-BY license.")
![Immunocytochemistry Pax3/Pax7 Antibody (274212) [Unconjugated]](https://images.novusbio.com/images2/Pax3_MAB2457_Immunocytochemistry__Immunofluorescence_20313.jpg)
![Immunocytochemistry/ Immunofluorescence Pax3/Pax7 Antibody (274212) [Unconjugated]](https://images.novusbio.com/images/mab2457_human-mouse-pax3-pax7-mab-clone-274212-41202412512639.jpg)
![Immunocytochemistry Pax2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax2_AF3364_Immunocytochemistry_14405.jpg)
![Western Blot Pax2 Antibody [Unconjugated]](https://images.novusbio.com/images2/af3364_human-pax2-affinity-purified-polyclonal-ab-western-blot-145202183852.jpg)
![Immunohistochemistry Pax2 Antibody [Unconjugated]](https://images.novusbio.com/images2/af3364_human-pax2-affinity-purified-polyclonal-ab-immunohistochemistry-192021142455.jpg)
![SDS-PAGE BMP-4 [Unconjugated]](https://images.novusbio.com/images2/BMP-4_314-BP_100.jpg)
![Bioactivity BMP-4 [Unconjugated]](https://images.novusbio.com/images2/314-bp_recombinant-human-bmp-4-protein-1882021123744.jpg)
![SDS-PAGE FGF-8 [Unconjugated]](https://images.novusbio.com/images2/FGF-8_423-F8_332.jpg)
![Bioactivity FGF-8 [Unconjugated]](https://images.novusbio.com/images2/FGF8_423F8_1438.jpg)
![Cell Culture FGF-8 [Unconjugated]](https://images.novusbio.com/images/423-f8_recombinant-human-mouse-fgf-8b-protein-cell-culture-1052024145159..jpg)
![Western Blot MSX1 Antibody [Unconjugated]](https://images.novusbio.com/images2/MSX1_AF5045_Western_Blot_5607.jpg)
![Immunohistochemistry MSX1 Antibody [Unconjugated]](https://images.novusbio.com/images2/MSX1_AF5045_Immunohistochemistry_15258.jpg)
![Western Blot MSX1 Antibody [Unconjugated]](https://images.novusbio.com/images/af5045_human-mouse-msx1-affinity-purified-polyclonal-ab-41202412402511.jpg)
![Simple Western Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Simple_Western_17126.jpg)
![Immunocytochemistry Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Immunocytochemistry_14427.jpg)
![Western Blot Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Western_Blot_14743.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")