![Immunohistochemistry-Paraffin: ERK1 Antibody (0B0C1) [NBP3-15776] - Immunohistochemistry of paraffin-embedded human lung cancer using ERK1 Rabbit mAb (NBP3-15776) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/ERK1-Antibody-0B0C1-Immunohistochemistry-Paraffin-NBP3-15776-img0002.jpg "Immunohistochemistry-Paraffin: ERK1 Antibody (0B0C1) [NBP3-15776] - Immunohistochemistry of paraffin-embedded human lung cancer using ERK1 Rabbit mAb (NBP3-15776) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC, IP |
| Clone | 0B0C1 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ERK1 (P27361). MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENV |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | MAPK3 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for ERK1 Antibody (NBP3-15776)Find related products by research area.
|
|
Read full blog post. |
|
Read full blog post. |
|
The role of c-Fos in the regulation of the JC virus gene transcription c-Fos is a member of the AP-1 transcription factor family under the Fos protein family umbrella, alongside Fra-1, Fra-2 and Fos-B. Also in the AP-1 transcription family are the Jun proteins, c-Jun, Jun-B and Jun-D. Each member of the AP-1 transcri... Read full blog post. |
|
The effects of curcumin on IKB Alpha and the NFkB signaling pathway The IKK complex, or inhibitor of NFkB kinase, is composed of IKK alpha and IKK beta. These kinases are at the core of the NFkB signaling cascade. The NFkB family is made up of transcription factors that are kept inactive in the cytoplasm through... Read full blog post. |
|
MAPK3/ERK1 - A signal transduction pathway with roles in development and disease Mitogen-activated protein kinases (MAPKs) are important signaling proteins needed to transmit and relay extracellular stimuli and to illicit intracellular responses (1). The MAPK family of proteins are serine/threonine kinases that are able to phos... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MAPK3 |
![Immunohistochemistry-Paraffin: ERK1 Antibody (0B0C1) [NBP3-15776] - Immunohistochemistry of paraffin-embedded human colon carcinoma using ERK1 Rabbit mAb (NBP3-15776) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/ERK1-Antibody-0B0C1-Immunohistochemistry-Paraffin-NBP3-15776-img0001.jpg "Immunohistochemistry-Paraffin: ERK1 Antibody (0B0C1) [NBP3-15776] - Immunohistochemistry of paraffin-embedded human colon carcinoma using ERK1 Rabbit mAb (NBP3-15776) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunoprecipitation: ERK1 Antibody (0B0C1) [NBP3-15776] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug ERK1 antibody (NBP3-15776). Western blot was performed from the immunoprecipitate using ERK1 antibody (NBP3-15776) at a dilition of 1:1000.](http://images.novusbio.com/fullsize/ERK1-Antibody-0B0C1-Immunoprecipitation-NBP3-15776-img0004.jpg "Immunoprecipitation: ERK1 Antibody (0B0C1) [NBP3-15776] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug ERK1 antibody (NBP3-15776). Western blot was performed from the immunoprecipitate using ERK1 antibody (NBP3-15776) at a dilition of 1:1000.")
![ERK1 Antibody (0B0C1) [NBP3-15776] -Analysis of various lysates, using ERK1 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.](http://images.novusbio.com/fullsize/nbp3-15776_rabbit-erk1-mab-0b0c1-western-blot-244202310354.jpg "ERK1 Antibody (0B0C1) [NBP3-15776] -Analysis of various lysates, using ERK1 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.")
![ERK1 Antibody (0B0C1) [NBP3-15776] -Analysis of extracts from wild type(WT) and ERK1 knockout (KO) 293T cells, using ERK1 antibody 19561) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.](http://images.novusbio.com/fullsize/nbp3-15776_rabbit-erk1-mab-0b0c1-western-blot-2442023103658.jpg "ERK1 Antibody (0B0C1) [NBP3-15776] -Analysis of extracts from wild type(WT) and ERK1 knockout (KO) 293T cells, using ERK1 antibody 19561) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")