Home » EMP/MAEA » EMP/MAEA Proteins » EMP/MAEA Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

EMP/MAEA Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for EMP/MAEA Recombinant Protein Antigen (NBP2-55034PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

EMP/MAEA Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EMP/MAEA.

Source: E. coli

Amino Acid Sequence: GVVEKLSVLKRKAVESIQAEDESAKLCKRRIEHLKEHSSDQPAAASVWKRKRMDRMMVEHLLRCGYYNTAVKL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MAEA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55034.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for EMP/MAEA Recombinant Protein Antigen

  • EMLP
  • EMP
  • EMPCell proliferation-inducing gene 5 protein
  • Erythroblast macrophage protein
  • HLC-10
  • Human lung cancer oncogene 10 protein
  • lung cancer-related protein 10
  • macrophage erythroblast attacher
  • MAEA
  • PIG5
  • proliferation-inducing gene 5

Background

The MAEA gene product mediates the attachment of erythroblasts to macrophages. This attachment promotes terminal maturationand enucleation of erythroblasts, presumably by suppressing apoptosis. This protein is an integral membrane proteinwith the N-terminus o

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Kallikrein 3/PSA
[HRP]
DKK300
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
(17 Publications)
Species: Hu
Applications: ELISA
E-Selectin/CD62E
Antibody (BBIG-E4) [U ...
BBA16
Immunohistochemistry E-Selectin/CD62E Antibody (BBIG-E4) [Unconjugated]
Immunocytochemistry E-Selectin/CD62E Antibody (BBIG-E4) [Unconjugated]
Flow Cytometry E-Selectin/CD62E Antibody (BBIG-E4) [Unconjugated]
(1 Review)
(60 Publications)
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
CD31/PECAM-1
Antibody [Unconjugate
AF3628
Immunohistochemistry CD31/PECAM-1 Antibody [Unconjugated]
Flow Cytometry CD31/PECAM-1 Antibody [Unconjugated]
Immunohistochemistry CD31/PECAM-1 Antibody [Unconjugated]
(6 Reviews)
(478 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, WB
PSAT1 Antibody
NBP1-32920
Western Blot PSAT1 Antibody
Immunocytochemistry/ Immunofluorescence PSAT1 Antibody
Immunohistochemistry-Paraffin PSAT1 Antibody
(12 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Protein S/PROS1
Antibody [Unconjugate
AF4036
Western Blot Protein S/PROS1 Antibody [Unconjugated]
Simple Western Protein S/PROS1 Antibody [Unconjugated]
(7 Publications)
Species: Hu
Applications: Simple Western, WB
PLAG1 Antibody
(3B7)
H00005324-M02
Immunohistochemistry PLAG1 Antibody (3B7)
Immunohistochemistry PLAG1 Antibody (3B7)
ELISA PLAG1 Antibody (3B7)
(20 Publications)
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB

Puromycin-sensitive am ...
NBP2-13669
Immunohistochemistry-Paraffin Puromycin-sensitive aminopeptidase/NPEPPS Antibody
Immunohistochemistry Puromycin-sensitive aminopeptidase/NPEPPS Antibody
Immunohistochemistry-Paraffin Puromycin-sensitive aminopeptidase/NPEPPS Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Hemoglobin alpha
Antibody - BSA Free
NB110-41083
Hemoglobin alpha Antibody - BSA Free
(12 Publications)
Species: Hu
Applications: ChIP, ELISA, ICC/IF, WB
Annexin V
Apoptosis Kit [FITC]
NBP2-29373
Flow Cytometry Annexin V Apoptosis Kit [FITC]
Flow Cytometry Annexin V Apoptosis Kit [FITC]
Flow Cytometry Annexin V Apoptosis Kit [FITC]
(2 Reviews)
(32 Publications)
Species: Hu, Mu, Rt
Applications: Flow-CS, Flow, ICC/IF
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(808 Publications)
Species: Hu
Applications: BA
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
VE-Cadherin
Antibody [Unconjugate
AF1002
Immunohistochemistry VE-Cadherin Antibody [Unconjugated]
Western Blot VE-Cadherin Antibody [Unconjugated]
Simple Western VE-Cadherin Antibody [Unconjugated]
(3 Reviews)
(116 Publications)
Species: Mu
Applications: Dual ISH-IHC, IHC, Simple Western, WB
P-Selectin/CD62P
137-PS
P-Selectin/CD62P
(45 Publications)
Species: Hu
Applications: BA
Erythropoietin/EPO
[HRP]
MEP00B
N/A Erythropoietin/EPO [HRP]
N/A Erythropoietin/EPO [HRP]
(104 Publications)
Species: Mu
Applications: ELISA
C-Reactive
Protein/CRP [Biotin]
DY1707
N/A C-Reactive Protein/CRP [Biotin]
(67 Publications)
Species: Hu
Applications: ELISA
ICAM-1/CD54
Antibody [Unconjugate
AF796
Immunohistochemistry ICAM-1/CD54 Antibody [Unconjugated]
Western Blot ICAM-1/CD54 Antibody [Unconjugated]
Western Blot ICAM-1/CD54 Antibody [Unconjugated]
(6 Reviews)
(85 Publications)
Species: Mu
Applications: AdBlk, IHC, WB
EMP1 Antibody
NBP3-24816
Immunocytochemistry/ Immunofluorescence EMP1 Antibody
Species: Hu
Applications: ICC/IF
Tight Junction
Protein 1 Antibody
NBP1-85047
Immunocytochemistry/ Immunofluorescence Tight Junction Protein 1 Antibody
Immunocytochemistry/ Immunofluorescence Tight Junction Protein 1 Antibody
Immunohistochemistry-Paraffin Tight Junction Protein 1 Antibody
(5 Reviews)
(20 Publications)
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB

Publications for EMP/MAEA Recombinant Protein Antigen (NBP2-55034PEP) (0)

There are no publications for EMP/MAEA Recombinant Protein Antigen (NBP2-55034PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EMP/MAEA Recombinant Protein Antigen (NBP2-55034PEP) (0)

There are no reviews for EMP/MAEA Recombinant Protein Antigen (NBP2-55034PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for EMP/MAEA Recombinant Protein Antigen (NBP2-55034PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EMP/MAEA Products

Research Areas for EMP/MAEA Recombinant Protein Antigen (NBP2-55034PEP)

Find related products by research area.

Blogs on EMP/MAEA

There are no specific blogs for EMP/MAEA, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
CD31/PECAM-1 was detected in immersion fixed frozen sections of mouse embryo (E13.5) using Goat Anti-Human/Mouse/Rat CD31/PECAM-1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3628) at 10 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (yellow; NL001) and counterstained with DAPI (blue). Specific staining was localized to developing endothelium. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
CD31/PECAM-1 Antibody [Unconjugated]
AF3628

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our EMP/MAEA Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MAEA