![Western Blot: ELOF1 Antibody (4F6) [H00084337-M06] - Analysis of ELOF1 expression in transfected 293T cell line by ELOF1 monoclonal antibody (M06), clone 4F6. Lane 1: ELOF1 transfected lysate (Predicted MW: 9.5 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/ELOF1-Antibody-4F6-Western-Blot-H00084337-M06-img0002.jpg "Western Blot: ELOF1 Antibody (4F6) [H00084337-M06] - Analysis of ELOF1 expression in transfected 293T cell line by ELOF1 monoclonal antibody (M06), clone 4F6. Lane 1: ELOF1 transfected lysate (Predicted MW: 9.5 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 4F6 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | ELOF1 (NP_115753.1, 1 a.a. ~ 83 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGRRKSKRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAANQ |
| Specificity | This product is specific for Human ELOF1 monoclonal antibody (M06), clone 4F6 [Gene ID: 84337]. |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | ELOF1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Mouse monoclonal antibody raised against a full-length recombinant ELOF1. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Western Blot Ets-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ets-1_AF7284_Western_Blot_11854.jpg)
![Immunohistochemistry Ets-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ets1_AF7284_Immunohistochemistry_22698.jpg)
![Immunocytochemistry FosB/G0S3 Antibody [Unconjugated]](https://images.novusbio.com/images2/FosB_AF2214_Immunocytochemistry__Immunofluorescence_21634.jpg)
![Immunohistochemistry FosB/G0S3 Antibody [Unconjugated]](https://images.novusbio.com/images2/FosB_AF2214_Immunohistochemistry_9938.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ELOF1 |
| Uniprot |
|
![Sandwich ELISA: ELOF1 Antibody (4F6) [H00084337-M06] - Detection limit for recombinant GST tagged ELOF1 is 0.1 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/ELOF1-Antibody-4F6-Sandwich-ELISA-H00084337-M06-img0001.jpg "Sandwich ELISA: ELOF1 Antibody (4F6) [H00084337-M06] - Detection limit for recombinant GST tagged ELOF1 is 0.1 ng/ml as a capture antibody.")
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
