Novus Biologicals products are now on bio-techne.com

EAAT2/GLT1 Antibody

Images

 
Western Blot: EAAT2/GLT1 Antibody [NBP1-59632] - Fetal Brain Lane A: Primary Antibody Lane B:Primary Antibody + Blocking Peptide Primary Antibody Concentration:1ug/ml Peptide Concentration: 5ug/ml Lysate Quantity: ...read more
Immunohistochemistry-Paraffin: EAAT2/GLT1 Antibody [NBP1-59632] - Human alveolar cell.
Western Blot: EAAT2/GLT1 Antibody [NBP1-59632] - Titration: 0.2-1 ug/ml, Positive Control: Human brain.
Western Blot: EAAT2/GLT1 Antibody [NBP1-59632] - WB analysis of GLT1 in Hep3B WCL. Image courtesy of anonymous customer product review.
Western Blot: EAAT2/GLT1 Antibody [NBP1-59632] - Human Fetal Brain lysates.
Immunohistochemistry-Paraffin: EAAT2/GLT1 Antibody [NBP1-59632] - Human Brain, cortex tissue at an antibody concentration of 5 ug/ml.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

EAAT2/GLT1 Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to SLC1A2(solute carrier family 1 (glial high affinity glutamate transporter), member 2) The peptide sequence was selected from the N terminal of SLC1A2 (NP_004162). PGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTK The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC1A2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
  • Western Blot 1.0 ug/ml
Theoretical MW
62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using
NBP1-59632 in the following applications:

  • 2 publications
  • WB
    2 publications

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 29880832).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for EAAT2/GLT1 Antibody

  • EAAT2
  • GLT1
  • member 2
  • SLC1A2
  • solute carrier family 1 (glial high affinity glutamate transporter), member 2
  • Solute carrier family 1 member 2

Background

SLC1A2 is a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. Mutations in and decreased expression of this protein are associated with amyotrophic lateral sclerosis. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.This gene encodes a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. Mutations in and decreased expression of this protein are associated with amyotrophic lateral sclerosis. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1869
Species: Hu, Mu, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-59319
Species: Hu, Rt
Applications: ICC/IF, IP, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP3-13360
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-81802
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-88191
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB110-39113
Species: Hu, Mu, Rb, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
NBP1-87679
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
236-EG
Species: Hu
Applications: BA
NBP3-13165
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NLS892
Species: Bt, Bv, Ca, Ha, Hu, Mu, Po, Rb, Rt
Applications: ICC, IHC, IHC-P, WB
NBP1-59632
Species: Hu, Mu
Applications: WB, IHC

Publications for EAAT2/GLT1 Antibody (NBP1-59632)(5)

Reviews for EAAT2/GLT1 Antibody (NBP1-59632) (0)

There are no reviews for EAAT2/GLT1 Antibody (NBP1-59632). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EAAT2/GLT1 Antibody (NBP1-59632). (Showing 1 - 1 of 1 FAQs).

  1. Can you please advise if NBP1-59632, GLT1 Antibody, will work on denatured protein?
    • This antibody has been generated using a synthetic peptides corresponding to a sequence from the N terminal of SLC1A2 (NP_004162). PGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPE. In general, the antibodies generated against partial peptides binds to proteins in their denatured form and in WB, this antibody was validated under reducing and denaturing conditions at our end. However, because the antigen sequence corresponds to the extracellular topological domain and the antibody worked perfectly in IHC as well (where protein targets are more in their native state), I assume that in WB also, this antibody should be able to detect GLT1 in its native state.

Secondary Antibodies

 

Isotype Controls

Additional EAAT2/GLT1 Products

Research Areas for EAAT2/GLT1 Antibody (NBP1-59632)

Find related products by research area.

Blogs on EAAT2/GLT1.

Deriving neural precursor cells from human induced pluripotent stem cells
By Jennifer Sokolowski, MD, PhD.Human induced pluripotent stem cells (iPSCs) can be used to create models of human organ systems and are useful for a) ascertaining the mechanisms underlying pathological conditions...  Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EAAT2/GLT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC1A2
Entrez
Uniprot