![Immunohistochemistry-Paraffin: Dysferlin Antibody [NBP1-84695] - Staining of human testis shows moderate membranous positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/Dysferlin-Antibody-Immunohistochemistry-Paraffin-NBP1-84695-img0015.jpg "Immunohistochemistry-Paraffin: Dysferlin Antibody [NBP1-84695] - Staining of human testis shows moderate membranous positivity in cells in seminiferous ducts.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CHYYYLPWGNVKPVVVLSSYWEDISHRIETQNQLLGIADRLEAGLEQVHLALKAQCSTEDVDSLVAQLTDELIAGCSQPLGDIHETPSATHLDQYLYQLRTHHLSQITEAALALKLGHSELPAALEQAEDWLLRLRALA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DYSF |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Choline Kinase beta [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Choline Kinase beta [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
Research Areas for Dysferlin Antibody (NBP1-84695)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DYSF |
![Immunohistochemistry-Paraffin: Dysferlin Antibody [NBP1-84695] - Staining of human skeletal muscle shows high expression.](http://images.novusbio.com/fullsize/Dysferlin-Antibody-Immunohistochemistry-Paraffin-NBP1-84695-img0005.jpg "Immunohistochemistry-Paraffin: Dysferlin Antibody [NBP1-84695] - Staining of human skeletal muscle shows high expression.")
![Immunohistochemistry-Paraffin: Dysferlin Antibody [NBP1-84695] - Staining of human skin shows low expression as expected.](http://images.novusbio.com/fullsize/Dysferlin-Antibody-Immunohistochemistry-Paraffin-NBP1-84695-img0006.jpg "Immunohistochemistry-Paraffin: Dysferlin Antibody [NBP1-84695] - Staining of human skin shows low expression as expected.")
![Immunohistochemistry-Paraffin: Dysferlin Antibody [NBP1-84695] - Staining in human skeletal muscle and skin tissues using anti-DYSF antibody. Corresponding DYSF RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Dysferlin-Antibody-Immunohistochemistry-Paraffin-NBP1-84695-img0007.jpg "Immunohistochemistry-Paraffin: Dysferlin Antibody [NBP1-84695] - Staining in human skeletal muscle and skin tissues using anti-DYSF antibody. Corresponding DYSF RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Dysferlin Antibody [NBP1-84695] - Staining of human kidney.](http://images.novusbio.com/fullsize/Dysferlin-Antibody-Immunohistochemistry-Paraffin-NBP1-84695-img0009.jpg "Immunohistochemistry-Paraffin: Dysferlin Antibody [NBP1-84695] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: Dysferlin Antibody [NBP1-84695] - Staining of human testis.](http://images.novusbio.com/fullsize/Dysferlin-Antibody-Immunohistochemistry-Paraffin-NBP1-84695-img0010.jpg "Immunohistochemistry-Paraffin: Dysferlin Antibody [NBP1-84695] - Staining of human testis.")
![Immunohistochemistry-Paraffin: Dysferlin Antibody [NBP1-84695] - Analysis in human skeletal muscle and skin tissues. Corresponding Dysferlin RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Dysferlin-Antibody-Immunohistochemistry-Paraffin-NBP1-84695-img0011.jpg "Immunohistochemistry-Paraffin: Dysferlin Antibody [NBP1-84695] - Analysis in human skeletal muscle and skin tissues. Corresponding Dysferlin RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Dysferlin Antibody [NBP1-84695] - Staining of human kidney, skeletal muscle, skin and testis using Anti-Dysferlin antibody NBP1-84695 (A) shows similar protein distribution across tissues to independent antibody NBP1-84696 (B).](http://images.novusbio.com/fullsize/Dysferlin-Antibody-Immunohistochemistry-Paraffin-NBP1-84695-img0012.jpg "Immunohistochemistry-Paraffin: Dysferlin Antibody [NBP1-84695] - Staining of human kidney, skeletal muscle, skin and testis using Anti-Dysferlin antibody NBP1-84695 (A) shows similar protein distribution across tissues to independent antibody NBP1-84696 (B).")
![Immunohistochemistry-Paraffin: Dysferlin Antibody [NBP1-84695] - Staining of human kidney shows moderate to strong membranous positivity in cells in glomeruli and cells in tubules.](http://images.novusbio.com/fullsize/Dysferlin-Antibody-Immunohistochemistry-Paraffin-NBP1-84695-img0013.jpg "Immunohistochemistry-Paraffin: Dysferlin Antibody [NBP1-84695] - Staining of human kidney shows moderate to strong membranous positivity in cells in glomeruli and cells in tubules.")
![Immunohistochemistry-Paraffin: Dysferlin Antibody [NBP1-84695] - Staining of human skin shows no positivity in squamous epithelial cells as expected.](http://images.novusbio.com/fullsize/Dysferlin-Antibody-Immunohistochemistry-Paraffin-NBP1-84695-img0014.jpg "Immunohistochemistry-Paraffin: Dysferlin Antibody [NBP1-84695] - Staining of human skin shows no positivity in squamous epithelial cells as expected.")
![Immunohistochemistry Dystroglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Dystroglycan_AF6868_Immunohistochemistry_11019.jpg)
![Western Blot Dystroglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Dystroglycan_AF6868_Western_Blot_11065.jpg)
![Knockout Validated Dystroglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Dystroglycan_AF6868_Knockout_Validated_23118.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")