![Immunocytochemistry/Immunofluorescence: DRIL1 Antibody [NBP1-89938] - Staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & vesicles.](http://images.novusbio.com/fullsize/DRIL1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89938-img0005.jpg "Immunocytochemistry/Immunofluorescence: DRIL1 Antibody [NBP1-89938] - Staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & vesicles.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVSLAGHPVVAAQAAAVQAAAAQAAVAAQAAALEQLREKLESAEPPEKKMALVADEQQRLMQRALQQ |
| Predicted Species | Mouse (94%), Rat (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ARID3A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Western_Blot_11082.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11144.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11480.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: DRIL1 Antibody [NBP1-89938] - Staining of human liver.](http://images.novusbio.com/fullsize/DRIL1-Antibody-Immunohistochemistry-Paraffin-NBP1-89938-img0012.jpg "Immunohistochemistry-Paraffin: DRIL1 Antibody [NBP1-89938] - Staining of human liver.")
![Immunohistochemistry-Paraffin: DRIL1 Antibody [NBP1-89938] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/DRIL1-Antibody-Immunohistochemistry-Paraffin-NBP1-89938-img0007.jpg "Immunohistochemistry-Paraffin: DRIL1 Antibody [NBP1-89938] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: DRIL1 Antibody [NBP1-89938] - Staining of human placenta shows high expression.](http://images.novusbio.com/fullsize/DRIL1-Antibody-Immunohistochemistry-Paraffin-NBP1-89938-img0008.jpg "Immunohistochemistry-Paraffin: DRIL1 Antibody [NBP1-89938] - Staining of human placenta shows high expression.")
![Immunohistochemistry-Paraffin: DRIL1 Antibody [NBP1-89938] - Staining in human placenta and pancreas tissues using anti-ARID3A antibody. Corresponding ARID3A RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/DRIL1-Antibody-Immunohistochemistry-Paraffin-NBP1-89938-img0009.jpg "Immunohistochemistry-Paraffin: DRIL1 Antibody [NBP1-89938] - Staining in human placenta and pancreas tissues using anti-ARID3A antibody. Corresponding ARID3A RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: DRIL1 Antibody [NBP1-89938] - Staining of human liver, placenta, testis and tonsil using Anti-ARID3A antibody NBP1-89938 (A) shows similar protein distribution across tissues to independent antibody NBP2-62705 (B).](http://images.novusbio.com/fullsize/DRIL1-Antibody-Immunohistochemistry-Paraffin-NBP1-89938-img0010.jpg "Immunohistochemistry-Paraffin: DRIL1 Antibody [NBP1-89938] - Staining of human liver, placenta, testis and tonsil using Anti-ARID3A antibody NBP1-89938 (A) shows similar protein distribution across tissues to independent antibody NBP2-62705 (B).")
![Immunohistochemistry-Paraffin: DRIL1 Antibody [NBP1-89938] - Staining of human tonsil.](http://images.novusbio.com/fullsize/DRIL1-Antibody-Immunohistochemistry-Paraffin-NBP1-89938-img0011.jpg "Immunohistochemistry-Paraffin: DRIL1 Antibody [NBP1-89938] - Staining of human tonsil.")
![Immunohistochemistry-Paraffin: DRIL1 Antibody [NBP1-89938] - Staining of human testis.](http://images.novusbio.com/fullsize/DRIL1-Antibody-Immunohistochemistry-Paraffin-NBP1-89938-img0013.jpg "Immunohistochemistry-Paraffin: DRIL1 Antibody [NBP1-89938] - Staining of human testis.")
![Immunohistochemistry BTK [p Tyr223] Antibody - BSA Free](https://images.novusbio.com/images/BTK-[p-Tyr223]-Antibody-Immunohistochemistry-NBP1-78295-img0002.jpg)
![Western Blot BTK [p Tyr223] Antibody - BSA Free](https://images.novusbio.com/images/BTK-[p-Tyr223]-Antibody-Western-Blot-NBP1-78295-img0004.jpg)
![Neutralization TRAILR1/TNFRSF10A Antibody [Unconjugated]](https://images.novusbio.com/images2/TRAIL_R1_AF347_Block_Neutralize_875.jpg)
![Western Blot TRAILR1/TNFRSF10A Antibody [Unconjugated]](https://images.novusbio.com/images2/TRAIL_R1_AF347_Western_Blot_5303.jpg)
![Immunohistochemistry TRAILR1/TNFRSF10A Antibody [Unconjugated]](https://images.novusbio.com/images2/TRAIL_R1_AF347_Immunohistochemistry_17355.jpg)
![Western Blot IRF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/IRF1_AF4715_Western_Blot_5529.jpg)
![Western Blot IRF1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af4715_mouse-irf1-affinity-purified-polyclonal-ab-western-blot-16122024101037..png)
![Western Blot RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Western_Blot_10216.jpg)
![Immunocytochemistry RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Immunocytochemistry_10464.jpg)
![Simple Western RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Simple_Western_16629.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")