![Western Blot: DNA Primase large subunit Antibody [NBP2-84798] - WB Suggested Anti-PRIM2 Antibody Titration: 5.0ug/ml. Positive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that PRIM2 is expressed in HepG2](http://images.novusbio.com/fullsize/DNA-Primase-large-subunit-Antibody-Western-Blot-NBP2-84798-img0001.jpg "Western Blot: DNA Primase large subunit Antibody [NBP2-84798] - WB Suggested Anti-PRIM2 Antibody Titration: 5.0ug/ml. Positive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that PRIM2 is expressed in HepG2")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 1 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human DNA Primase large subunit. Peptide sequence: QDFLKDSQLQFEAISDEEKTLREQEIVASSPSLSGLKLGFKSIYKPPFAS The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PRIM2 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 1 mg/ml |
| Purity | Protein A purified |
![Western Blot PKLR Antibody [Unconjugated]](https://images.novusbio.com/images2/PKLR_AF8519_Western_Blot_16592.jpg)
![Simple Western PKLR Antibody [Unconjugated]](https://images.novusbio.com/images2/af8519_human-mouse-rat-pklr-affinity-purified-pab-simple-western-1342022154119.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for DNA Primase large subunit Antibody (NBP2-84798)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PRIM2 |
![Flow Cytometry KIR2DL3/CD158b2 Antibody (180701) [Unconjugated]](https://images.novusbio.com/images2/KIR2DL3_MAB2014_Flow_Cytometry_23697.jpg)
![CD94 Antibody (131412) [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "CD94 Antibody (131412) [Unconjugated]")
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
