Home » DNA Primase small subunit » DNA Primase small subunit Antibodies » DNA Primase small subunit Antibody
Novus Biologicals products are now on bio-techne.com

DNA Primase small subunit Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: DNA Primase small subunit Antibody [NBP1-90897] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
Immunocytochemistry/ Immunofluorescence: DNA Primase small subunit Antibody [NBP1-90897] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DNA Primase small subunit Antibody [NBP1-90897] - Staining of human bone marrow shows cytoplasmic positivity in hematopoietic cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

DNA Primase small subunit Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSG
Predicted Species
Mouse (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRIM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DNA Primase small subunit Protein (NBP1-90897PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DNA Primase small subunit Antibody

  • DNA primase 1
  • DNA primase 49 kDa subunit
  • DNA primase small subunit
  • DNA primase subunit 48
  • EC 2.7.7
  • EC 2.7.7.-
  • MGC12308
  • p49
  • primase p49 subunit
  • primase polypeptide 1, 49kDa
  • primase, DNA, polypeptide 1 (49kDa)

Background

DNA Primase small subunit, also known by its gene name PRIM1, is a heterodimer that is composed of a small and large subunit. PRIM1 is 420 amino acids long and approximately 49kDa. The DNA Primase small subunit synthesizes RNA primers for the Okazaki fragments created during discontinuous DNA replication. Current research surrounding PRIM1 has shown a possible link with carcinomas, malaria, neuronitis, and osteosarcoma. DNA Primase small subunit has also been shown to interact with Histone cluster 1 H4/A, H4/B, H4/C, H4/D and H4/E in pathways such as DNA replication, DNA strand elongation, polymerase switching, and lagging strand synthesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
ARHGEF7 Antibody
NBP1-88650
Western Blot ARHGEF7 Antibody
Immunohistochemistry-Paraffin ARHGEF7 Antibody
Immunohistochemistry-Paraffin ARHGEF7 Antibody
Species: Hu
Applications: IHC, IHC-P, KD, WB
Human, Mouse, Rat
RelA/NFkB p65 ELISA K ...
NBP2-29661
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
(95 Publications)
Species: Hu, Mu, Rt
Applications: ELISA
ASCC1 Antibody
(OTI6G5)
NBP2-01345
Flow Cytometry ASCC1 Antibody (OTI6G5)
Flow Cytometry ASCC1 Antibody (OTI6G5)
Western Blot ASCC1 Antibody (OTI6G5)
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
CD40/TNFRSF5
Antibody (mAb89)
DDX0131P-100
Immunocytochemistry/ Immunofluorescence CD40/TNFRSF5 Antibody (mAb89)
Immunohistochemistry CD40/TNFRSF5 Antibody (mAb89)
(13 Publications)
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
DNA Primase large
subunit Antibody - Az ...
NBP2-92044
Western Blot DNA Primase large subunit Antibody - Azide and BSA Free
Western Blot DNA Primase large subunit Antibody - Azide and BSA Free
Species: Hu, Mu
Applications: WB
WNK1 Antibody
[Unconjugated]
AF2849
Western Blot WNK1 Antibody [Unconjugated]
(5 Publications)
Species: Mu, Rt
Applications: WB
CDK5 Activator 1
Antibody
NBP3-13279
Immunocytochemistry/ Immunofluorescence CDK5 Activator 1 Antibody
Immunohistochemistry-Paraffin CDK5 Activator 1 Antibody
Immunohistochemistry-Paraffin CDK5 Activator 1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
GRASP65 Antibody
(OTI5G8)
NBP2-02665
Immunocytochemistry/ Immunofluorescence GRASP65 Antibody (OTI5G8)
Immunocytochemistry/ Immunofluorescence GRASP65 Antibody (OTI5G8)
Flow Cytometry GRASP65 Antibody (OTI5G8)
(3 Reviews)
(2 Publications)
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Synaptotagmin 1
Antibody (ASV48) [Unc ...
MAB4364
Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]
Immunohistochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]
Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]
(2 Publications)
Species: Rt
Applications: ICC, IHC, IP, KO, WB
c-Rel Antibody
[Unconjugated]
AF2699
Simple Western c-Rel Antibody [Unconjugated]
Western Blot c-Rel Antibody [Unconjugated]
(1 Review)
(3 Publications)
Species: Mu
Applications: Simple Western, WB
NFkB2/NFkB p100
Antibody
NBP1-87760
Immunohistochemistry-Paraffin NFkB2/NFkB p100 Antibody
Immunohistochemistry-Paraffin NFkB2/NFkB p100 Antibody
Immunohistochemistry-Paraffin NFkB2/NFkB p100 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Ficolin-2
[Unconjugated]
2428-FC
Ficolin-2 [Unconjugated]
(2 Publications)
Species: Hu
Applications: Bind
CDCA5 Antibody
NBP1-89530
Western Blot CDCA5 Antibody
Immunohistochemistry-Paraffin CDCA5 Antibody
Immunocytochemistry/ Immunofluorescence CDCA5 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Annexin A1
Antibody [Unconjugate
AF3770
Western Blot Annexin A1 Antibody [Unconjugated]
Immunohistochemistry Annexin A1 Antibody [Unconjugated]
Simple Western Annexin A1 Antibody [Unconjugated]
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Uroplakin IIIB
Antibody
NBP1-92564
Immunohistochemistry-Paraffin Uroplakin IIIB Antibody
Immunohistochemistry-Paraffin Uroplakin IIIB Antibody
Immunohistochemistry-Paraffin Uroplakin IIIB Antibody
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
GCHFR Antibody
(846011) [Unconjugate
MAB7918
Simple Western GCHFR Antibody (846011) [Unconjugated]
Western Blot GCHFR Antibody (846011) [Unconjugated]
Species: Hu
Applications: Simple Western, WB
IL-12
[Unconjugated]
419-ML
SDS-PAGE IL-12 [Unconjugated]
Bioactivity IL-12 [Unconjugated]
(273 Publications)
Species: Mu
Applications: BA
KIR2DL3/CD158b2
Antibody (180701) [Un ...
MAB2014
Flow Cytometry KIR2DL3/CD158b2 Antibody (180701) [Unconjugated]
(12 Publications)
Species: Hu
Applications: CyTOF-reported, Flow
DNAJC3 Antibody
NBP2-48704
Western Blot DNAJC3 Antibody
Immunohistochemistry-Paraffin DNAJC3 Antibody
Immunocytochemistry/ Immunofluorescence DNAJC3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for DNA Primase small subunit Antibody (NBP1-90897) (0)

There are no publications for DNA Primase small subunit Antibody (NBP1-90897).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNA Primase small subunit Antibody (NBP1-90897) (0)

There are no reviews for DNA Primase small subunit Antibody (NBP1-90897). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DNA Primase small subunit Antibody (NBP1-90897) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNA Primase small subunit Products

Research Areas for DNA Primase small subunit Antibody (NBP1-90897)

Find related products by research area.

Blogs on DNA Primase small subunit

There are no specific blogs for DNA Primase small subunit, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNA Primase small subunit Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PRIM1