Home » DNA Ligase IV » DNA Ligase IV Proteins » DNA Ligase IV Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

DNA Ligase IV Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for DNA Ligase IV Protein (NBP1-87405PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

DNA Ligase IV Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LIG4.

Source: E. coli

Amino Acid Sequence: TYCVIAGSENIRVKNIILSNKHDVVKPAWLLECFKTKSFVPWQPRFMIHMCPSTKEHFAREYDCYGDSYFIDTDLNQLKEVFSGIKNSNEQTPEEMASLIADLEYRYSWDCSPLSMFRRHTVYLDSYA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LIG4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87405.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DNA Ligase IV Recombinant Protein Antigen

  • DNA joinase
  • DNA ligase 4
  • DNA Ligase IV
  • DNA repair enzyme
  • EC 6.5.1.1
  • LIG4
  • ligase IV, DNA, ATP-dependent
  • Polydeoxyribonucleotide synthase [ATP] 4
  • polynucleotide ligase
  • sealase

Background

LIG4 encodes a DNA ligase that joins single-strand breaks in a double-stranded polydeoxynucleotide in an ATP-dependent reaction. This protein is essential for V(D)J recombination and DNA double-strand break (DSB) repair through nonhomologous end joining (NHEJ). This protein forms a complex with the X-ray repair cross complementing protein 4 (XRCC4), and further interacts with the DNA-dependent protein kinase (DNA-PK). Both XRCC4 and DNA-PK are known to be required for NHEJ. The crystal structure of the complex formed by this protein and XRCC4 has been resolved. Defects in this gene are the cause of LIG4 syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

APE Antibody
(13B8E5C2) - BSA Free
NB100-116
Immunocytochemistry/ Immunofluorescence APE Antibody (13B8E5C2) - BSA Free
Western Blot APE Antibody (13B8E5C2) - BSA Free
Chromatin Immunoprecipitation (ChIP) APE Antibody (13B8E5C2) - BSA Free
(3 Reviews)
(107 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, PLA, Simple Western, WB
XRCC4 Antibody
NBP1-89463
Immunocytochemistry/ Immunofluorescence XRCC4 Antibody
Western Blot XRCC4 Antibody
Immunohistochemistry-Paraffin XRCC4 Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
PARP Antibody
(194C1439) - Cleaved ...
NBP2-27335
Immunocytochemistry/ Immunofluorescence PARP Antibody (194C1439) - Cleaved - Azide and BSA Free
Western Blot PARP Antibody (194C1439) - Cleaved - Azide and BSA Free
Western Blot PARP Antibody (194C1439) - Cleaved - Azide and BSA Free
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
MGMT Antibody (MT
23.2) - BSA Free
NB100-168
Flow (Intracellular) MGMT Antibody (MT 23.2) - BSA Free
Flow Cytometry MGMT Antibody (MT 23.2) - BSA Free
Flow (Intracellular) MGMT Antibody (MT 23.2) - BSA Free
(21 Publications)
Species: Hu, Mu(-)
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
DNA-PKcs Antibody
(3H6) - BSA Free
NBP2-22128
ELISA DNA-PKcs Antibody (3H6) - BSA Free
Western Blot DNA-PKcs Antibody (3H6) - BSA Free
Immunocytochemistry/ Immunofluorescence DNA-PKcs Antibody (3H6) - BSA Free
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
OGG1 Antibody -
BSA Free
NB100-106
Flow Cytometry OGG1 Antibody - BSA Free
Immunohistochemistry OGG1 Antibody - BSA Free
Immunohistochemistry OGG1 Antibody - BSA Free
(5 Reviews)
(132 Publications)
Species: Hu, Mu, Po, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, WB
Ku80/XRCC5
Antibody - BSA Free
NB100-508
Western Blot Ku80/XRCC5 Antibody - BSA Free
Immunoprecipitation Ku80/XRCC5 Antibody - BSA Free
Western Blot Ku80/XRCC5 Antibody - BSA Free
(1 Review)
(5 Publications)
Species: Ha, Hu, Mu, Rt
Applications: ChIP, IP, WB
Ku70/XRCC6
Antibody (KU729)
NBP2-34247
Flow Cytometry Ku70/XRCC6 Antibody (KU729)
Flow Cytometry Ku70/XRCC6 Antibody (KU729)
Immunocytochemistry/ Immunofluorescence Ku70/XRCC6 Antibody (KU729)
(1 Review)
Species: Ch(-), Hu, Mu(-), Pm, Rt(-)
Applications: Flow-IC, Flow, ICC/IF
UNG Antibody
NB600-1031
Western Blot UNG Antibody
Immunohistochemistry-Paraffin UNG Antibody
(5 Publications)
Species: Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Collagen XI alpha
2 Antibody (473)
NBP2-43728
Immunocytochemistry/ Immunofluorescence Collagen XI alpha 2 Antibody (473)
Western Blot Collagen XI alpha 2 Antibody (473)
Western Blot Collagen XI alpha 2 Antibody (473)
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Artemis Antibody -
BSA Free
NB100-183
Western Blot Artemis Antibody - BSA Free
(1 Review)
(1 Publication)
Species: Hu
Applications: WB
Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
(7 Reviews)
(389 Publications)
Species: Hu, Mu
Applications: ICC, IHC
XLF Antibody
(OTI3D6)
NBP2-03275
Western Blot XLF Antibody (OTI3D6)
Flow Cytometry XLF Antibody (OTI3D6)
Immunocytochemistry/ Immunofluorescence XLF Antibody (OTI3D6)
(2 Publications)
Species: Hu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Nbs1 Antibody
NB100-143
Knockout Validated Nbs1 Antibody
Western Blot Nbs1 Antibody
Knockdown Validated Nbs1 Antibody
(8 Reviews)
(204 Publications)
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, ISH, KD, KO, PAGE, WB
ATM Antibody (2C1)
NB100-309
Knockdown Validated ATM Antibody (2C1)
Knockdown Validated ATM Antibody (2C1)
Immunoprecipitation ATM Antibody (2C1)
(3 Reviews)
(131 Publications)
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB

Publications for DNA Ligase IV Protein (NBP1-87405PEP) (0)

There are no publications for DNA Ligase IV Protein (NBP1-87405PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNA Ligase IV Protein (NBP1-87405PEP) (0)

There are no reviews for DNA Ligase IV Protein (NBP1-87405PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DNA Ligase IV Protein (NBP1-87405PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DNA Ligase IV Products

Research Areas for DNA Ligase IV Protein (NBP1-87405PEP)

Find related products by research area.

Blogs on DNA Ligase IV

There are no specific blogs for DNA Ligase IV, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Caspase‑3 was detected in immersion fixed anti-FAS treated Jurkat human acute T cell leukemia cell line using 0.3 µg/mL Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) for 3 hours at room temperature. Cells were stained (red) and counterstained (green). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Caspase-3 Antibody [Unconjugated] - Active
AF835
Knockout Validated: Nbs1 Antibody [NB100-143] - Lysates of HeLa human cervical epithelial carcinoma parental cell line and Nbs1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Rabbit Anti-Human Polyclonal [NB100-143] followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (HAF008). Specific band was detected for Nbs1 at approximately 95 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Nbs1 Antibody
NB100-143

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DNA Ligase IV Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol LIG4