![Western Blot: Dkk-3 Antibody [NBP1-80843] - Analysis in control (vector only transfected HEK293T lysate) and DKK3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/Dkk-3-Antibody-Western-Blot-NBP1-80843-img0006.jpg "Western Blot: Dkk-3 Antibody [NBP1-80843] - Analysis in control (vector only transfected HEK293T lysate) and DKK3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CGDQLCVWGHCTKMATRGSNGTICDNQRDCQPGLCCAFQRGLLFPVCTPLPVEGELCHDPASRLLDLITWELEPDGALDRCPCASGLLCQPHSHSLVYVCKPTFVGSRDQDGEILLPREVPDEYLAASW |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DKK3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Western_Blot_5100.jpg)
![Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Chromatin_Immunoprecipitation_11251.jpg)
![Simple Western beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/betaCatenin_AF1329_Simple_Western_17134.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Dkk-3 Antibody (NBP1-80843)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: Dkk-3 Antibody [NBP1-80843] - Staining of human cell line A-431 shows localization to vesicles.](http://images.novusbio.com/fullsize/Dkk-3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80843-img0004.jpg "Immunocytochemistry/Immunofluorescence: Dkk-3 Antibody [NBP1-80843] - Staining of human cell line A-431 shows localization to vesicles.")
![Immunohistochemistry-Paraffin: Dkk-3 Antibody [NBP1-80843] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/Dkk-3-Antibody-Immunohistochemistry-Paraffin-NBP1-80843-img0009.jpg "Immunohistochemistry-Paraffin: Dkk-3 Antibody [NBP1-80843] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Immunohistochemistry-Paraffin: Dkk-3 Antibody [NBP1-80843] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/Dkk-3-Antibody-Immunohistochemistry-Paraffin-NBP1-80843-img0007.jpg "Immunohistochemistry-Paraffin: Dkk-3 Antibody [NBP1-80843] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: Dkk-3 Antibody [NBP1-80843] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/Dkk-3-Antibody-Immunohistochemistry-Paraffin-NBP1-80843-img0008.jpg "Immunohistochemistry-Paraffin: Dkk-3 Antibody [NBP1-80843] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.")
![Cell Culture Dkk-1 [Unconjugated]](https://images.novusbio.com/images/5439-dk_recombinant-human-dkk-1-protein-105202416017.jpg)
![Cell Culture Dkk-1 [Unconjugated]](https://images.novusbio.com/images/5439-dk_recombinant-human-dkk-1-protein-cell-culture-105202416211..jpg)
![Bioactivity Dkk-1 [Unconjugated]](https://images.novusbio.com/images/5439-dk_recombinant-human-dkk-1-protein-bioactivity-135202491415..jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_5991.jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_6327.jpg)
![Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Immunocytochemistry__Immunofluorescence_20184.jpg)
![Bioactivity Dkk-4 [Unconjugated]](https://images.novusbio.com/images2/Dkk4_1269DKCF_1668.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")