Novus Biologicals products are now on bio-techne.com

Recombinant Human DIO3 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human DIO3 Protein [H00001735-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Recombinant Human DIO3 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-143 of Human DIO3

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MLRSLLLHSLRLCAQTASCLVLFPRFLGTAFMLWLLDFLCIRKHFLGRRRRGQPEPEVELNSEGEEVPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFFKQAHEGGPAPNSEVVLPDGFQSQHILDYAQGNRPLVLNFGSCT

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
DIO3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
41.47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DIO3 GST (N-Term) Protein

  • 5DIII
  • D3
  • deiodinase, iodothyronine, type III
  • DIOIII
  • EC 1.97.1
  • EC 1.97.1.11
  • ITDI3
  • placental type
  • thyroxine deiodinase type III (selenoprotein)
  • Type 3 DI
  • type 3 iodothyronine selenodeiodinase
  • type III iodothyronine deiodinase
  • type-III 5' deiodinase
  • Type-III 5'-deiodinase

Background

DIO3( AAH17717, 1 a.a. - 144 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-00178
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89396
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56725
Species: Hu, Mu
Applications: Flow-IC, Flow, IHC, IHC-P, IP, WB
NBP3-12391
Species: Hu, Mu, Rt
Applications: DB, ELISA, ICC/IF, IP, WB
MAB7665
Species: Hu
Applications: IHC, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-31308
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB6570
Species: Hu
Applications: IHC, WB
NBP2-92630
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-13225
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NLS3921
Species: Hu, Pm, Pm
Applications: IHC, IHC-P
NBP2-00776
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00138428-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP3-25443
Species: Hu, Mu, Rt
Applications: Func, ICC/IF, IHC, IHC-P, WB
H00001735-P01
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP

Publications for DIO3 Recombinant Protein (H00001735-P01) (0)

There are no publications for DIO3 Recombinant Protein (H00001735-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DIO3 Recombinant Protein (H00001735-P01) (0)

There are no reviews for DIO3 Recombinant Protein (H00001735-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DIO3 Recombinant Protein (H00001735-P01). (Showing 1 - 2 of 2 FAQ).

  1. I am looking for a Dio3 peptide that I can inject in vivo to produce a biological effect. Can you provide information or confirm whether the Dio3 peptide you have would be effective as a biological agent in vivo?
    • I have pulled up information on the Dio3 peptides and recombinant proteins that we have available. Unfortunately I would not expect any of them to be biologically active and capable of producing a response when injected in vivo. The two peptides we carry are simply intended to be used for negative control competition assays to block signal of the primary and determine what is specific and non-specific as far as signal is concerned. The other two recombinant proteins are ones we distribute for a Taiwanese company called Abnova and they should not be biologically active based on the cell free wheat germ system employed to synthesize them. We will typically list our active proteins with an indication of such on our datasheet if it has been tested and usually the application of functional listed.
  2. I recently purchased the DIO3 antibody (NBP1-19747) and I am looking for a positive control for western blotting.
    • H00001735-P01 is a protein produced by a Taiwanese company called Abnova and we distribute it for them. It is generally intended to be used with their antibodies. NBP2-04196 is a better choice for use with NBP1-19747.

Additional DIO3 Products

Array H00001735-P01

Research Areas for DIO3 Recombinant Protein (H00001735-P01)

Find related products by research area.

Blogs on DIO3

There are no specific blogs for DIO3, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DIO3 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DIO3