Recombinant Human DIO3 GST (N-Term) Protein Summary
Description |
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-143 of Human DIO3 Source: Wheat Germ (in vitro) Amino Acid Sequence: MLRSLLLHSLRLCAQTASCLVLFPRFLGTAFMLWLLDFLCIRKHFLGRRRRGQPEPEVELNSEGEEVPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFFKQAHEGGPAPNSEVVLPDGFQSQHILDYAQGNRPLVLNFGSCT |
Preparation Method |
in vitro wheat germ expression system |
Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
Source |
Wheat germ |
Protein/Peptide Type |
Recombinant Protein |
Gene |
DIO3 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- SDS-Page
- Western Blot
|
Theoretical MW |
41.47 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -80C. Avoid freeze-thaw cycles. |
Buffer |
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human DIO3 GST (N-Term) Protein
Background
DIO3( AAH17717, 1 a.a. - 144 a.a.) recombinant protein with GST.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: DB, ELISA, ICC/IF, IP, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Pm
Applications: IHC, IHC-P
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: Func, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP
Publications for DIO3 Recombinant Protein (H00001735-P01) (0)
There are no publications for DIO3 Recombinant Protein (H00001735-P01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DIO3 Recombinant Protein (H00001735-P01) (0)
There are no reviews for DIO3 Recombinant Protein (H00001735-P01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DIO3 Recombinant Protein (H00001735-P01). (Showing 1 - 2 of 2 FAQ).
-
I am looking for a Dio3 peptide that I can inject in vivo to produce a biological effect. Can you provide information or confirm whether the Dio3 peptide you have would be effective as a biological agent in vivo?
- I have pulled up information on the Dio3 peptides and recombinant proteins that we have available. Unfortunately I would not expect any of them to be biologically active and capable of producing a response when injected in vivo. The two peptides we carry are simply intended to be used for negative control competition assays to block signal of the primary and determine what is specific and non-specific as far as signal is concerned. The other two recombinant proteins are ones we distribute for a Taiwanese company called Abnova and they should not be biologically active based on the cell free wheat germ system employed to synthesize them. We will typically list our active proteins with an indication of such on our datasheet if it has been tested and usually the application of functional listed.
-
I recently purchased the DIO3 antibody (NBP1-19747) and I am looking for a positive control for western blotting.
- H00001735-P01 is a protein produced by a Taiwanese company called Abnova and we distribute it for them. It is generally intended to be used with their antibodies. NBP2-04196 is a better choice for use with NBP1-19747.
Additional DIO3 Products
Research Areas for DIO3 Recombinant Protein (H00001735-P01)
Find related products by research area.
|
Blogs on DIO3