![Immunohistochemistry-Paraffin: Desmin Antibody [NBP1-85549] - Staining in human heart muscle and liver tissues . Corresponding DES RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Desmin-Antibody-Immunohistochemistry-Paraffin-NBP1-85549-img0012.jpg "Immunohistochemistry-Paraffin: Desmin Antibody [NBP1-85549] - Staining in human heart muscle and liver tissues . Corresponding DES RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL |
| Predicted Species | Mouse (98%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DES |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Simple_Western_17480.jpg)
![Western Blot CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Western_Blot_18637.jpg)
![Immunohistochemistry CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/SCF_R_AF1356_Immunohistochemistry_9746.jpg)
![Myoglobin Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Myoglobin Antibody [Unconjugated]")
| Publications using NBP1-85549 | Applications | Species |
|---|---|---|
| Gry M, Oksvold P, Ponten F et al. Tissue specific protein expression in human cells, tissues and organs. J Proteomics Bioinform 2010-01-01 | ||
| Yoshioka N, Kurose M, Yano M et al. Isoform-specific mutation in Dystonin-b gene causes late-onset protein aggregate myopathy and cardiomyopathy eLife 2022-08-09 [PMID: 35942699] (IHC-P, Mouse) Details: Dilution used 1:1000 |
IHC-P | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for Desmin Antibody (NBP1-85549)Find related products by research area.
|
|
Alpha-smooth muscle actin and the modulation of endothelial and epithelial cell biology Actin is essential for a wide range of cell functions, ranging from cell division and chromatin remodeling to vesicle trafficking and maintenance of cellular structure. In fact, mislocalization of actin to cell junctions during development leads t... Read full blog post. |
|
Vimentin in Wound Healing Vimentin is a fundamental 10 nm type III intermediate filament (IF) protein found in many mesenchymal and epithelia tissues, tissue culture cells, and developing neuronal and astrocytic precursor cells of the central nervous system. It frequently co-p... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DES |
![Western Blot: Desmin Antibody [NBP1-85549] - Analysis in human cell line RH-30.](http://images.novusbio.com/fullsize/Desmin-Antibody-Western-Blot-NBP1-85549-img0007.jpg "Western Blot: Desmin Antibody [NBP1-85549] - Analysis in human cell line RH-30.")
![Immunocytochemistry/Immunofluorescence: Desmin Antibody [NBP1-85549] - Staining of human cell line RH-30 shows localization to intermediate filaments. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Desmin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85549-img0005.jpg "Immunocytochemistry/Immunofluorescence: Desmin Antibody [NBP1-85549] - Staining of human cell line RH-30 shows localization to intermediate filaments. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Desmin Antibody [NBP1-85549] - Staining of human heart muscle shows moderate to strong cytoplasmic and membranous positivity in cardiomyocytes.](http://images.novusbio.com/fullsize/Desmin-Antibody-Immunohistochemistry-Paraffin-NBP1-85549-img0008.jpg "Immunohistochemistry-Paraffin: Desmin Antibody [NBP1-85549] - Staining of human heart muscle shows moderate to strong cytoplasmic and membranous positivity in cardiomyocytes.")
![Immunohistochemistry-Paraffin: Desmin Antibody [NBP1-85549] - Staining of human liver shows no positivity as expected.](http://images.novusbio.com/fullsize/Desmin-Antibody-Immunohistochemistry-Paraffin-NBP1-85549-img0009.jpg "Immunohistochemistry-Paraffin: Desmin Antibody [NBP1-85549] - Staining of human liver shows no positivity as expected.")
![Immunohistochemistry-Paraffin: Desmin Antibody [NBP1-85549] - Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.](http://images.novusbio.com/fullsize/Desmin-Antibody-Immunohistochemistry-Paraffin-NBP1-85549-img0010.jpg "Immunohistochemistry-Paraffin: Desmin Antibody [NBP1-85549] - Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.")
![Immunohistochemistry-Paraffin: Desmin Antibody [NBP1-85549] - Staining of human skeletal muscle shows strong cytoplasmic positivity in striated muscle fibers.](http://images.novusbio.com/fullsize/Desmin-Antibody-Immunohistochemistry-Paraffin-NBP1-85549-img0011.jpg "Immunohistochemistry-Paraffin: Desmin Antibody [NBP1-85549] - Staining of human skeletal muscle shows strong cytoplasmic positivity in striated muscle fibers.")
![Immunohistochemistry CD34 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD34_AF4117_Immunohistochemistry_6824.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22971.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22972.jpg)
![Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunocytochemistry_9890.jpg)
![SDS-PAGE IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_40.jpg)
![Bioactivity IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_41.jpg)
![Mass Spectrometry IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_42.jpg)
![Immunocytochemistry Nestin Antibody (196908) [Unconjugated]](https://images.novusbio.com/images2/Nestin_MAB1259_Immunocytochemistry_6561.jpg)
![Intracellular Staining by Flow Cytometry Nestin Antibody (196908) [Unconjugated]](https://images.novusbio.com/images/antibody/mab1259_human-nestin-mab-clone-196908-intracellular-staining-by-flow-cytometry-24120239959.jpg)
![Western Blot Nestin Antibody (196908) [Unconjugated]](https://images.novusbio.com/images/mab1259_human-nestin-mab-clone-196908-41202410481129.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")