![Immunohistochemistry-Paraffin: DDX25 Antibody [NBP1-83328] - Staining in human testis and endometrium tissues using anti-DDX25 antibody. Corresponding DDX25 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/DDX25-Antibody-Immunohistochemistry-Paraffin-NBP1-83328-img0010.jpg "Immunohistochemistry-Paraffin: DDX25 Antibody [NBP1-83328] - Staining in human testis and endometrium tissues using anti-DDX25 antibody. Corresponding DDX25 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NSHFSNLSQPRKNLWGIKSTAVRNIDGSINNINEDDEEDVVDLAANSLLNKLIHQSLVESSHRVEVLQKDPSSP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DDX25 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for DDX25 Antibody (NBP1-83328)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DDX25 |
![Western Blot: DDX25 Antibody [NBP1-83328] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-153](http://images.novusbio.com/fullsize/DDX25-Antibody-Western-Blot-NBP1-83328-img0005.jpg "Western Blot: DDX25 Antibody [NBP1-83328] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-153")
![Immunohistochemistry-Paraffin: DDX25 Antibody [NBP1-83328] - Staining of human endometrium shows low expression as expected.](http://images.novusbio.com/fullsize/DDX25-Antibody-Immunohistochemistry-Paraffin-NBP1-83328-img0007.jpg "Immunohistochemistry-Paraffin: DDX25 Antibody [NBP1-83328] - Staining of human endometrium shows low expression as expected.")
![Immunohistochemistry-Paraffin: DDX25 Antibody [NBP1-83328] - Staining of human hypothalamus shows strong cytoplasmic positivity in subsets of glial cells and in processes.](http://images.novusbio.com/fullsize/DDX25-Antibody-Immunohistochemistry-Paraffin-NBP1-83328-img0008.jpg "Immunohistochemistry-Paraffin: DDX25 Antibody [NBP1-83328] - Staining of human hypothalamus shows strong cytoplasmic positivity in subsets of glial cells and in processes.")
![Immunohistochemistry-Paraffin: DDX25 Antibody [NBP1-83328] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/DDX25-Antibody-Immunohistochemistry-Paraffin-NBP1-83328-img0009.jpg "Immunohistochemistry-Paraffin: DDX25 Antibody [NBP1-83328] - Staining of human testis shows high expression.")
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Immunohistochemistry SHBG Antibody [Unconjugated]](https://images.novusbio.com/images2/SHBG_AF2656_Immunohistochemistry_7324.jpg)
![Western Blot SHBG Antibody [Unconjugated]](https://images.novusbio.com/images/af2656_human-shbg-affinity-purified-pab-western-blot-2642023152834..jpg)
![Immunohistochemistry SHBG Antibody [Unconjugated]](https://images.novusbio.com/images/af2656_human-shbg-affinity-purified-pab-8120255541789.jpg)
![Western Blot VASA Antibody [Unconjugated]](https://images.novusbio.com/images2/VASA_AF2030_Western_Blot_16711.jpg)
![Immunohistochemistry VASA Antibody [Unconjugated]](https://images.novusbio.com/images2/VASA_AF2030_Immunohistochemistry_7144.jpg)
![Immunohistochemistry VASA Antibody [Unconjugated]](https://images.novusbio.com/images/af2030_human-vasa-affinity-purified-polyclonal-ab-4120241239493.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")