![Immunohistochemistry-Paraffin: Protamine 2 Antibody [NBP2-31637] - Analysis in human testis and fallopian tube tissues. Corresponding Protamine 2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Protamine-2-Antibody-Immunohistochemistry-Paraffin-NBP2-31637-img0011.jpg "Immunohistochemistry-Paraffin: Protamine 2 Antibody [NBP2-31637] - Analysis in human testis and fallopian tube tissues. Corresponding Protamine 2 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MVRYRVRSLSERSHEVYRQQLHGQEQGHHGQEEQGLSPEHVEVYERTHGQS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PRM2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publications using NBP2-31637 | Applications | Species |
|---|---|---|
| Djureinovic D, Fagerberg L, Hallstrom B et al. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Mol Hum Reprod 2014-06-01 [PMID: 24598113] | ||
| Flannigan R, Mielnik A, Robinson B et al. YBX2 Dysregulation is a Potential Cause for Late Maturation Arrest in Men with Non-Obstructive Azoospermia. bioRxiv 2018-07-09 (IF/IHC, Human) | IF/IHC | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Protamine 2 Antibody [NBP2-31637] - Staining of human testis shows strong nuclear positivity in spermatids.](http://images.novusbio.com/fullsize/Protamine-2-Antibody-Immunohistochemistry-Paraffin-NBP2-31637-img0014.jpg "Immunohistochemistry-Paraffin: Protamine 2 Antibody [NBP2-31637] - Staining of human testis shows strong nuclear positivity in spermatids.")
![Immunohistochemistry-Paraffin: Protamine 2 Antibody [NBP2-31637] - Staining of human fallopian tube shows low expression as expected.](http://images.novusbio.com/fullsize/Protamine-2-Antibody-Immunohistochemistry-Paraffin-NBP2-31637-img0008.jpg "Immunohistochemistry-Paraffin: Protamine 2 Antibody [NBP2-31637] - Staining of human fallopian tube shows low expression as expected.")
![Immunohistochemistry-Paraffin: Protamine 2 Antibody [NBP2-31637] - Staining of human cerebral cortex shows no positivity in neurons as expected.](http://images.novusbio.com/fullsize/Protamine-2-Antibody-Immunohistochemistry-Paraffin-NBP2-31637-img0012.jpg "Immunohistochemistry-Paraffin: Protamine 2 Antibody [NBP2-31637] - Staining of human cerebral cortex shows no positivity in neurons as expected.")
![Immunohistochemistry-Paraffin: Protamine 2 Antibody [NBP2-31637] - Staining of human prostate shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/Protamine-2-Antibody-Immunohistochemistry-Paraffin-NBP2-31637-img0013.jpg "Immunohistochemistry-Paraffin: Protamine 2 Antibody [NBP2-31637] - Staining of human prostate shows no positivity in glandular cells as expected.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")