Home » Cytochrome C Oxidase subunit 6c » Cytochrome C Oxidase subunit 6c Antibodies » Cytochrome C Oxidase subunit 6c Antibody (S51)
Novus Biologicals products are now on bio-techne.com

Cytochrome C Oxidase subunit 6c Antibody (S51)

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: Cytochrome C Oxidase subunit 6c Antibody (S51) [H00001345-M03] - Analysis of monoclonal antibody to COX6C on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 1 ug/ml
Immunohistochemistry-Paraffin: Cytochrome C Oxidase subunit 6c Antibody (S51) [H00001345-M03] - Analysis of monoclonal antibody to COX6C on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration ...read more
ELISA: Cytochrome C Oxidase subunit 6c Antibody (S51) [H00001345-M03] - Detection limit for recombinant GST tagged COX6C is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC
Clone
S51
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Cytochrome C Oxidase subunit 6c Antibody (S51) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
COX6C (AAH00187, 1 a.a. ~ 75 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK
Specificity
COX6C - cytochrome c oxidase subunit VIc
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
COX6C
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cytochrome C Oxidase subunit 6c Antibody (S51)

  • Cytochrome c oxidase polypeptide VIc
  • cytochrome c oxidase subunit 6C
  • cytochrome c oxidase subunit VIc preprotein
  • cytochrome c oxidase subunit VIc

Background

Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIc, which has 77% amino acid sequence identity with mouse COX subunit VIc. This gene is up-regulated in prostate cancer cells. A pseudogene COX6CP1 has been found on chromosomes 16p12.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

COX5A Antibody
NBP1-32550
Western Blot COX5A Antibody
Immunohistochemistry-Paraffin COX5A Antibody
Western Blot COX5A Antibody
(3 Publications)
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Recombinant Human
COX8A GST (N-Term) Pr ...
H00001351-P01
SDS-PAGE Recombinant Human COX8A GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
HMGA2 Antibody
[Unconjugated]
AF3184
Simple Western HMGA2 Antibody [Unconjugated]
Western Blot HMGA2 Antibody [Unconjugated]
Immunocytochemistry HMGA2 Antibody [Unconjugated]
(11 Publications)
Species: Hu, Mu
Applications: ICC, Simple Western, WB
CPOX Antibody
(36B10) - BSA Free
NBP2-59438
Immunocytochemistry/ Immunofluorescence CPOX Antibody (36B10) - BSA Free
Western Blot CPOX Antibody (36B10) - BSA Free
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, WB
Cytochrome c
Antibody (7H8.2C12) - ...
NB100-56503
Flow Cytometry Cytochrome c Antibody (7H8.2C12) - BSA Free
Flow (Intracellular) Cytochrome c Antibody (7H8.2C12) - BSA Free
Western Blot Cytochrome c Antibody (7H8.2C12) - BSA Free
(61 Publications)
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
COX6B1 Antibody
NBP1-85497
Immunocytochemistry/ Immunofluorescence COX6B1 Antibody
Immunohistochemistry-Paraffin COX6B1 Antibody
Immunohistochemistry-Paraffin COX6B1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
COX4 Antibody -
BSA Free
NB110-39115
Western Blot COX4 Antibody - BSA Free
Simple Western COX4 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence COX4 Antibody - BSA Free
(4 Reviews)
(19 Publications)
Species: Bv, Dr, Hu, I, Mu, Ma-Op, Po, Pm, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
mtTFA Antibody
(18G102B2E11)
NBP1-71648
Western Blot mtTFA Antibody (18G102B2E11)
Knockdown Validated mtTFA Antibody (18G102B2E11)
Western Blot mtTFA Antibody (18G102B2E11)
(2 Reviews)
(19 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, KO, Simple Western, WB
Recombinant Human
COX7C GST (N-Term) Pr ...
H00001350-P01
Other Recombinant Human COX7C GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
COX7A1 Antibody -
Azide and BSA Free
NBP2-92185
Immunohistochemistry-Paraffin COX7A1 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin COX7A1 Antibody - Azide and BSA Free
Western Blot COX7A1 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NDUFS3 Antibody
(1D6)
H00004722-M02
Western Blot NDUFS3 Antibody (1D6)
Immunohistochemistry-Paraffin NDUFS3 Antibody (1D6)
Immunoprecipitation NDUFS3 Antibody (1D6)
(1 Publication)
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, KD, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Recombinant Human
COX7B GST (N-Term) Pr ...
H00001349-P01
Other Recombinant Human COX7B GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
COX-1 Antibody
NBP1-85500
Immunocytochemistry/ Immunofluorescence COX-1 Antibody
Immunohistochemistry-Paraffin COX-1 Antibody
Immunohistochemistry-Paraffin COX-1 Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
APE Antibody
(13B8E5C2) - BSA Free
NB100-116
Immunocytochemistry/ Immunofluorescence APE Antibody (13B8E5C2) - BSA Free
Western Blot APE Antibody (13B8E5C2) - BSA Free
Chromatin Immunoprecipitation (ChIP) APE Antibody (13B8E5C2) - BSA Free
(3 Reviews)
(107 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, PLA, Simple Western, WB
COX6A1 Antibody -
BSA Free
NBP2-92889
Immunocytochemistry/ Immunofluorescence COX6A1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence COX6A1 Antibody - BSA Free
Immunohistochemistry-Paraffin COX6A1 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
COX6A2 Antibody
NBP1-31112
Western Blot COX6A2 Antibody
Immunocytochemistry/ Immunofluorescence COX6A2 Antibody
Immunohistochemistry-Paraffin COX6A2 Antibody
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Nuclear Factor
Erythroid 2 Related F ...
NBP2-93792
Immunocytochemistry/ Immunofluorescence Nuclear Factor Erythroid 2 Related Factor 1 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin Nuclear Factor Erythroid 2 Related Factor 1 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin Nuclear Factor Erythroid 2 Related Factor 1 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
TGF-beta 1
[Unconjugated]
7754-BH/CF
Bioactivity TGF-beta 1 [Unconjugated]
(53 Publications)
Species: Hu
Applications: BA
Cytochrome C
Oxidase subunit 6c An ...
H00001345-M03
Cytochrome C Oxidase subunit 6c Antibody (S51)
Species: Hu
Applications: WB, ELISA, IHC

Publications for Cytochrome C Oxidase subunit 6c Antibody (H00001345-M03) (0)

There are no publications for Cytochrome C Oxidase subunit 6c Antibody (H00001345-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytochrome C Oxidase subunit 6c Antibody (H00001345-M03) (0)

There are no reviews for Cytochrome C Oxidase subunit 6c Antibody (H00001345-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytochrome C Oxidase subunit 6c Antibody (H00001345-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cytochrome C Oxidase subunit 6c Products

Blogs on Cytochrome C Oxidase subunit 6c

There are no specific blogs for Cytochrome C Oxidase subunit 6c, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytochrome C Oxidase subunit 6c Antibody (S51) and receive a gift card or discount.


Bioinformatics

Gene Symbol COX6C
Entrez
OMIM
Uniprot