![Western Blot: COX6A1 Antibody [NBP2-92889] - Analysis of extracts of various cell lines, using COX6A1 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 60s.](http://images.novusbio.com/fullsize/COX6A1-Antibody-Western-Blot-NBP2-92889-img0006.jpg "Western Blot: COX6A1 Antibody [NBP2-92889] - Analysis of extracts of various cell lines, using COX6A1 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 60s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 25-109 of human COX6A1 (NP_004364.2). SSGAHGEEGSARMWKTLTFFVALPGVAVSMLNVYLKSHHGEHERPEFIAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYEDE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | COX6A1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Theoretical MW | 12 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP2-92889 | Applications | Species |
|---|---|---|
| Li W, Li H, Zheng L et al. Ginsenoside CK improves skeletal muscle insulin resistance by activating DRP1/PINK1-mediated mitophagy Food & function 2023-01-23 [PMID: 36562271] |
Secondary Antibodies |
Isotype Controls |
Research Areas for COX6A1 Antibody (NBP2-92889)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | COX6A1 |
![Immunocytochemistry/Immunofluorescence: COX6A1 Antibody [NBP2-92889] - Immunofluorescence analysis of C6 cells using COX6A1 Polyclonal Antibody (NBP2-92889) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/COX6A1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-92889-img0007.jpg "Immunocytochemistry/Immunofluorescence: COX6A1 Antibody [NBP2-92889] - Immunofluorescence analysis of C6 cells using COX6A1 Polyclonal Antibody (NBP2-92889) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: COX6A1 Antibody [NBP2-92889] - Rat cerebellum using COX6A1 antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/COX6A1-Antibody-Immunohistochemistry-Paraffin-NBP2-92889-img0005.jpg "Immunohistochemistry-Paraffin: COX6A1 Antibody [NBP2-92889] - Rat cerebellum using COX6A1 antibody at dilution of 1:100 (40x lens).")
![Immunocytochemistry/Immunofluorescence: COX6A1 Antibody [NBP2-92889] - Analysis of NIH-3T3 cells using COX6A1 . Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/COX6A1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-92889-img0001.jpg "Immunocytochemistry/Immunofluorescence: COX6A1 Antibody [NBP2-92889] - Analysis of NIH-3T3 cells using COX6A1 . Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: COX6A1 Antibody [NBP2-92889] - Analysis of U-2 OS cells using COX6A1 . Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/COX6A1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-92889-img0002.jpg "Immunocytochemistry/Immunofluorescence: COX6A1 Antibody [NBP2-92889] - Analysis of U-2 OS cells using COX6A1 . Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: COX6A1 Antibody [NBP2-92889] - Human liver cancer using COX6A1 antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/COX6A1-Antibody-Immunohistochemistry-Paraffin-NBP2-92889-img0003.jpg "Immunohistochemistry-Paraffin: COX6A1 Antibody [NBP2-92889] - Human liver cancer using COX6A1 antibody at dilution of 1:100 (40x lens).")
![Immunohistochemistry-Paraffin: COX6A1 Antibody [NBP2-92889] - Mouse liver using COX6A1 antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/COX6A1-Antibody-Immunohistochemistry-Paraffin-NBP2-92889-img0004.jpg "Immunohistochemistry-Paraffin: COX6A1 Antibody [NBP2-92889] - Mouse liver using COX6A1 antibody at dilution of 1:100 (40x lens).")
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Immunohistochemistry EphA3 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphA3_AF640_Immunohistochemistry_19184.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")