![Western Blot: Cystatin SN Antibody [H00001469-B01P] - Analysis of CST1 expression in transfected 293T cell line by CST1 polyclonal antibody. Lane 1: CST1 transfected lysate(15.51 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/Cystatin-SN-Antibody-Western-Blot-H00001469-B01P-img0002.jpg "Western Blot: Cystatin SN Antibody [H00001469-B01P] - Analysis of CST1 expression in transfected 293T cell line by CST1 polyclonal antibody. Lane 1: CST1 transfected lysate(15.51 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | CST1 (NP_001889.2, 1 a.a. - 141 a.a.) full-length human protein. MAQYLSTLLLLLATLAVALAWSPKEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES |
| Specificity | CST1 - cystatin SN, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | CST1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | IgG purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CST1 |
| Entrez |
|
| Uniprot |
|
![Immunohistochemistry: Cystatin SN Antibody [H00001469-B01P] - Representative immunostaining of Cystatin SN (CST1) expression in the nasal epithelium of 2 SAR patients a control subject. Magnification:x200. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0067057), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Cystatin-SN-Antibody-Immunohistochemistry-H00001469-B01P-img0005.jpg "Immunohistochemistry: Cystatin SN Antibody [H00001469-B01P] - Representative immunostaining of Cystatin SN (CST1) expression in the nasal epithelium of 2 SAR patients a control subject. Magnification:x200. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0067057), licensed under a CC-BY license.")
![Immunohistochemistry: Cystatin SN Antibody [H00001469-B01P] - Representative immunostaining of Cystatin SN (CST1) expression in the nasal epithelium of a SAR patient. Magnification:x200. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0067057), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Cystatin-SN-Antibody-Immunohistochemistry-H00001469-B01P-img0003.jpg "Immunohistochemistry: Cystatin SN Antibody [H00001469-B01P] - Representative immunostaining of Cystatin SN (CST1) expression in the nasal epithelium of a SAR patient. Magnification:x200. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0067057), licensed under a CC-BY license.")
![Immunohistochemistry: Cystatin SN Antibody [H00001469-B01P] - Representative immunostaining of Cystatin SN (CST1) expression in the nasal epithelium of a SAR patient. Magnification:x200. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0067057), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Cystatin-SN-Antibody-Immunohistochemistry-H00001469-B01P-img0004.jpg "Immunohistochemistry: Cystatin SN Antibody [H00001469-B01P] - Representative immunostaining of Cystatin SN (CST1) expression in the nasal epithelium of a SAR patient. Magnification:x200. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0067057), licensed under a CC-BY license.")
![Immunohistochemistry: Cystatin SN Antibody [H00001469-B01P] - Representative immunostaining of Cystatin SN (CST1) expression in the nasal epithelium of 2 SAR patients a control subject. Magnification:x200. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0067057), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Cystatin-SN-Antibody-Immunohistochemistry-H00001469-B01P-img0006.jpg "Immunohistochemistry: Cystatin SN Antibody [H00001469-B01P] - Representative immunostaining of Cystatin SN (CST1) expression in the nasal epithelium of 2 SAR patients a control subject. Magnification:x200. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0067057), licensed under a CC-BY license.")
![N/A Cystatin C [HRP]](https://images.novusbio.com/images2/Cystatin_C_MSCTC0_ELISA_321.jpg)
![N/A Cystatin C [HRP]](https://images.novusbio.com/images2/Cystatin_C_MSCTC0_ELISA_322.jpg)
![N/A Cystatin C [HRP]](https://images.novusbio.com/images2/DATA_Cystatin_C_MSCTC0_ELISA_1030.jpg)
![Western Blot Cathepsin C/DPPI Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_C_AF1034_Western_Blot_21534.jpg)
![Immunohistochemistry Cathepsin C/DPPI Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_C_AF1034_Immunohistochemistry_11463.jpg)
![Western Blot Cathepsin C/DPPI Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_C_AF1034_Western_Blot_16948.jpg)
![Western Blot Cystatin E/M/CST6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cystatin_E_M_AF1286_Western_Blot_20495.jpg)
![Simple Western Cystatin E/M/CST6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cystatin_E_M_AF1286_Simple_Western_20496.jpg)
![Immunohistochemistry Cathepsin B Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_B_AF965_Immunohistochemistry_6922.jpg)
![Immunocytochemistry/ Immunofluorescence Cathepsin B Antibody [Unconjugated]](https://images.novusbio.com/images/af965_mouse-cathepsin-b-affinity-purified-polyclonal-ab-822024950321.jpg)
![Immunocytochemistry/ Immunofluorescence Cathepsin B Antibody [Unconjugated]](https://images.novusbio.com/images/af965_mouse-cathepsin-b-affinity-purified-polyclonal-ab-822024950468.jpg)
![Immunohistochemistry Trypsin 3/PRSS3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Trypsin_3_AF3565_Immunohistochemistry_6794.jpg)
![Immunohistochemistry Trypsin 3/PRSS3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Trypsin_3_AF3565_Immunohistochemistry_9788.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")