![Western Blot: Cyclin T1 Antibody [NBP3-05509] - Analysis in HeLa cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-CCNT1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/Cyclin-T1-Antibody-Western-Blot-NBP3-05509-img0003.jpg "Western Blot: Cyclin T1 Antibody [NBP3-05509] - Analysis in HeLa cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-CCNT1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KTSEQTILNMISQSSSDTTIAGLMSMSTSTTSAVPSLPVSEESSSNLTSVEMLPGKRWLSSQPSFKLEPTQGHRTSENLALTGVDHSLPQDGSNAFISQKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLEN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CCNT1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF fixation permeabilization use PFA/Triton X-100. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, pH 7.2, containing 40% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Cyclin T1 Antibody (NBP3-05509)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CCNT1 |
![Western Blot: Cyclin T1 Antibody [NBP3-05509] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/Cyclin-T1-Antibody-Western-Blot-NBP3-05509-img0004.jpg "Western Blot: Cyclin T1 Antibody [NBP3-05509] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunocytochemistry/Immunofluorescence: Cyclin T1 Antibody [NBP3-05509] - Staining of human cell line U-251 MG shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/Cyclin-T1-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-05509-img0001.jpg "Immunocytochemistry/Immunofluorescence: Cyclin T1 Antibody [NBP3-05509] - Staining of human cell line U-251 MG shows localization to nucleoplasm.")
![Immunohistochemistry-Paraffin: Cyclin T1 Antibody [NBP3-05509] - Staining of human liver shows no positivity in hepatocytes.](http://images.novusbio.com/fullsize/Cyclin-T1-Antibody-Immunohistochemistry-Paraffin-NBP3-05509-img0008.jpg "Immunohistochemistry-Paraffin: Cyclin T1 Antibody [NBP3-05509] - Staining of human liver shows no positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: Cyclin T1 Antibody [NBP3-05509] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/Cyclin-T1-Antibody-Immunohistochemistry-Paraffin-NBP3-05509-img0005.jpg "Immunohistochemistry-Paraffin: Cyclin T1 Antibody [NBP3-05509] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: Cyclin T1 Antibody [NBP3-05509] - Staining of human lymph node shows moderate to strong nuclear positivity in germinal center cells.](http://images.novusbio.com/fullsize/Cyclin-T1-Antibody-Immunohistochemistry-Paraffin-NBP3-05509-img0006.jpg "Immunohistochemistry-Paraffin: Cyclin T1 Antibody [NBP3-05509] - Staining of human lymph node shows moderate to strong nuclear positivity in germinal center cells.")
![Immunohistochemistry-Paraffin: Cyclin T1 Antibody [NBP3-05509] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/Cyclin-T1-Antibody-Immunohistochemistry-Paraffin-NBP3-05509-img0007.jpg "Immunohistochemistry-Paraffin: Cyclin T1 Antibody [NBP3-05509] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot Progranulin/PGRN Antibody [Unconjugated]](https://images.novusbio.com/images2/Progranulin_AF2557_Western_Blot_15520.jpg)
![Immunohistochemistry Progranulin/PGRN Antibody [Unconjugated]](https://images.novusbio.com/images2/Progranulin_AF2557_Immunohistochemistry_7155.jpg)
![Immunocytochemistry Progranulin/PGRN Antibody [Unconjugated]](https://images.novusbio.com/images2/Progranulin_AF2557_Immunocytochemistry__Immunofluorescence_23051.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")