Novus Biologicals products are now on bio-techne.com

CTGF/CCN2 Recombinant Protein Antigen

Images

 
There are currently no images for CTGF/CCN2 Recombinant Protein Antigen (NBP2-61415PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

CTGF/CCN2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CTGF.

Source: E. coli

Amino Acid Sequence: LPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CCN2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-61415.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CTGF/CCN2 Recombinant Protein Antigen

  • CCN2
  • CCN2IGFBP-8
  • connective tissue growth factor
  • CTGF
  • CTGRP
  • Fisp12
  • HCS24
  • Hypertrophic chondrocyte-specific protein 24
  • IBP-8
  • IGF-binding protein 8
  • IGFBP-8
  • IGFBP8CCN family member 2
  • Insulin-like growth factor-binding protein 8
  • MGC102839
  • NOV2

Background

Connective Tissue Growth Factor (CTGF) is a 38kDa, cysteine-rich, secreted peptide. CTGF promotes endothelial cell growth, migration, adhesion and survival. and is thus implicated in endothelial cell function and angiogenesis. CTGF is implicated in are embryogenesis, wound healing and regulation of extracellular matrix production, and is required for normal skeletal growth.

CTGF antibodies are useful tools for angiogenesis and cell structure research, and for studies on certian types of cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1640
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
7754-BH/CF
Species: Hu
Applications: BA
AF4055
Species: Mu
Applications: IHC, Simple Western, WB
DVE00
Species: Hu
Applications: ELISA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF4309
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP1-84037
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF3797
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
NB100-56479
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
DCP00
Species: Hu
Applications: ELISA
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
DTM100
Species: Hu
Applications: ELISA
DTSP10
Species: Hu
Applications: ELISA

Publications for CTGF/CCN2 Recombinant Protein Antigen (NBP2-61415PEP) (0)

There are no publications for CTGF/CCN2 Recombinant Protein Antigen (NBP2-61415PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CTGF/CCN2 Recombinant Protein Antigen (NBP2-61415PEP) (0)

There are no reviews for CTGF/CCN2 Recombinant Protein Antigen (NBP2-61415PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CTGF/CCN2 Recombinant Protein Antigen (NBP2-61415PEP). (Showing 1 - 1 of 1 FAQ).

  1. We are looking for a pair of mouse CTGF antibody for ELISA, we prefer no azide and/or glycerol, and in carrier free form (no EDTA, no Tris, no BSA). For the validation, we need approximately 100ug. If it works, we'll order more later.
    • Unfortunately we do not carry any CTGF antibodies that suit your specifications. We do carry AbSelect antibody purification kits that will remove BSA, Tris and azide from antibody formulations which may be an option for you.

Additional CTGF/CCN2 Products

Research Areas for CTGF/CCN2 Recombinant Protein Antigen (NBP2-61415PEP)

Find related products by research area.

Blogs on CTGF/CCN2

There are no specific blogs for CTGF/CCN2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CTGF/CCN2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CCN2