![Western Blot: CS Citrate Synthase Antibody (CL2553) [NBP2-36773] - Lane 1: Marker [kDa]. Lane 2:Human cell line U-251 MG](http://images.novusbio.com/fullsize/CS-Citrate-Synthase-Antibody-CL2553-Western-Blot-NBP2-36773-img0007.jpg "Western Blot: CS Citrate Synthase Antibody (CL2553) [NBP2-36773] - Lane 1: Marker [kDa]. Lane 2:Human cell line U-251 MG")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clone | CL2553 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:ADLIPKEQARIKTFRQQHGKTVVGQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFRGFSIPECQKLLPKAKGGEEPLPEGLFWLLVTGHIPTEEQVSWL |
| Epitope | GLFWLLVTGHIPTEE |
| Predicted Species | Mouse (93%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | CS |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CS Citrate Synthase Antibody (NBP2-36773)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (CL2553) [NBP2-36773] - Staining in MCF7 cell line with Anti-CS monoclonal antibody, showing specific mitochondrial staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CS-Citrate-Synthase-Antibody-CL2553-Immunocytochemistry-Immunofluorescence-NBP2-36773-img0013.jpg "Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (CL2553) [NBP2-36773] - Staining in MCF7 cell line with Anti-CS monoclonal antibody, showing specific mitochondrial staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.")
![Immunohistochemistry: CS Citrate Synthase Antibody (CL2553) [NBP2-36773] - Staining of human kidney shows granular cytoplasmic immunoreactivity in renal tubules.](http://images.novusbio.com/fullsize/CS-Citrate-Synthase-Antibody-CL2553-Immunohistochemistry-NBP2-36773-img0006.jpg "Immunohistochemistry: CS Citrate Synthase Antibody (CL2553) [NBP2-36773] - Staining of human kidney shows granular cytoplasmic immunoreactivity in renal tubules.")
![Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (CL2553) [NBP2-36773] - Staining in HeLa cell line showing specific mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CS-Citrate-Synthase-Antibody-CL2553-Immunocytochemistry-Immunofluorescence-NBP2-36773-img0008.jpg "Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (CL2553) [NBP2-36773] - Staining in HeLa cell line showing specific mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.")
![Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (CL2553) [NBP2-36773] - Staining of human cell line A431 showing specific mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CS-Citrate-Synthase-Antibody-CL2553-Immunocytochemistry-Immunofluorescence-NBP2-36773-img0009.jpg "Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (CL2553) [NBP2-36773] - Staining of human cell line A431 showing specific mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.")
![Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (CL2553) [NBP2-36773] - Staining in U2OS cell line with Anti-CS monoclonal antibody, showing specific mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CS-Citrate-Synthase-Antibody-CL2553-Immunocytochemistry-Immunofluorescence-NBP2-36773-img0011.jpg "Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (CL2553) [NBP2-36773] - Staining in U2OS cell line with Anti-CS monoclonal antibody, showing specific mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.")
![Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (CL2553) [NBP2-36773] - Staining in U251 cell line showing specific mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CS-Citrate-Synthase-Antibody-CL2553-Immunocytochemistry-Immunofluorescence-NBP2-36773-img0012.jpg "Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (CL2553) [NBP2-36773] - Staining in U251 cell line showing specific mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.")
![Immunohistochemistry: CS Citrate Synthase Antibody (CL2553) [NBP2-36773] - Staining of human fallopian tube shows strong granular cytoplasmic immunoreactivity in glandular cells.](http://images.novusbio.com/fullsize/CS-Citrate-Synthase-Antibody-CL2553-Immunohistochemistry-NBP2-36773-img0001.jpg "Immunohistochemistry: CS Citrate Synthase Antibody (CL2553) [NBP2-36773] - Staining of human fallopian tube shows strong granular cytoplasmic immunoreactivity in glandular cells.")
![Immunohistochemistry: CS Citrate Synthase Antibody (CL2553) [NBP2-36773] - Staining of human breast cancer shows strong granular cytoplasmic positivity in tumor cells.](http://images.novusbio.com/fullsize/CS-Citrate-Synthase-Antibody-CL2553-Immunohistochemistry-NBP2-36773-img0002.jpg "Immunohistochemistry: CS Citrate Synthase Antibody (CL2553) [NBP2-36773] - Staining of human breast cancer shows strong granular cytoplasmic positivity in tumor cells.")
![Immunohistochemistry: CS Citrate Synthase Antibody (CL2553) [NBP2-36773] - Staining of human rectum shows strong granular cytoplasmic immunoreactivity in glandular cells.](http://images.novusbio.com/fullsize/CS-Citrate-Synthase-Antibody-CL2553-Immunohistochemistry-NBP2-36773-img0003.jpg "Immunohistochemistry: CS Citrate Synthase Antibody (CL2553) [NBP2-36773] - Staining of human rectum shows strong granular cytoplasmic immunoreactivity in glandular cells.")
![Immunohistochemistry: CS Citrate Synthase Antibody (CL2553) [NBP2-36773] - Staining of human small intestine shows granular cytoplasmic immunoreactivity in both glandular and lamina propria cells.](http://images.novusbio.com/fullsize/CS-Citrate-Synthase-Antibody-CL2553-Immunohistochemistry-NBP2-36773-img0004.jpg "Immunohistochemistry: CS Citrate Synthase Antibody (CL2553) [NBP2-36773] - Staining of human small intestine shows granular cytoplasmic immunoreactivity in both glandular and lamina propria cells.")
![Immunohistochemistry: CS Citrate Synthase Antibody (CL2553) [NBP2-36773] - Staining of human prostate shows granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/CS-Citrate-Synthase-Antibody-CL2553-Immunohistochemistry-NBP2-36773-img0005.jpg "Immunohistochemistry: CS Citrate Synthase Antibody (CL2553) [NBP2-36773] - Staining of human prostate shows granular cytoplasmic positivity in glandular cells.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Immunocytochemistry Nucleostemin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nucleostemin_AF1638_Immunocytochemistry_6472.jpg)
![Simple Western Nucleostemin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nucleostemin_AF1638_Simple_Western_18959.jpg)
![Western Blot Nucleostemin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nucleostemin_AF1638_Western_Blot_18960.jpg)
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")