![Western Blot: CS Citrate Synthase Antibody (CL2545) [NBP2-36771] - Lane 1: Marker [kDa]. Lane 2:Human cell line U-251 MG](http://images.novusbio.com/fullsize/CS-Citrate-Synthase-Antibody-CL2545-Western-Blot-NBP2-36771-img0008.jpg "Western Blot: CS Citrate Synthase Antibody (CL2545) [NBP2-36771] - Lane 1: Marker [kDa]. Lane 2:Human cell line U-251 MG")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clone | CL2545 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:ADLIPKEQARIKTFRQQHGKTVVGQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFRGFSIPECQKLLPKAKGGEEPLPEGLFWLLVTGHIPTEEQVSWL |
| Epitope | SVLDPDEGIRFRGFS |
| Predicted Species | Mouse (93%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | CS |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CS Citrate Synthase Antibody (NBP2-36771)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (CL2545) [NBP2-36771] - Staining in U251 cell line showing specific mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CS-Citrate-Synthase-Antibody-CL2545-Immunocytochemistry-Immunofluorescence-NBP2-36771-img0013.jpg "Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (CL2545) [NBP2-36771] - Staining in U251 cell line showing specific mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody (CL2545) [NBP2-36771] - Staining of human endometrium shows strong granular cytoplasmic immunoreactivity in glandular cells.](http://images.novusbio.com/fullsize/CS-Citrate-Synthase-Antibody-CL2545-Immunohistochemistry-NBP2-36771-img0007.jpg "Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody (CL2545) [NBP2-36771] - Staining of human endometrium shows strong granular cytoplasmic immunoreactivity in glandular cells.")
![Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (CL2545) [NBP2-36771] - Staining in HeLa cell line showing specific mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CS-Citrate-Synthase-Antibody-CL2545-Immunocytochemistry-Immunofluorescence-NBP2-36771-img0009.jpg "Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (CL2545) [NBP2-36771] - Staining in HeLa cell line showing specific mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.")
![Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (CL2545) [NBP2-36771] - Staining of human cell line A431 showing specific mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CS-Citrate-Synthase-Antibody-CL2545-Immunocytochemistry-Immunofluorescence-NBP2-36771-img0010.jpg "Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (CL2545) [NBP2-36771] - Staining of human cell line A431 showing specific mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.")
![Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (CL2545) [NBP2-36771] - Staining in MCF7 cell line showing specific mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CS-Citrate-Synthase-Antibody-CL2545-Immunocytochemistry-Immunofluorescence-NBP2-36771-img0011.jpg "Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (CL2545) [NBP2-36771] - Staining in MCF7 cell line showing specific mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.")
![Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (CL2545) [NBP2-36771] - Staining in U2OS cell line with Anti-CS monoclonal antibody, showing specific mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CS-Citrate-Synthase-Antibody-CL2545-Immunocytochemistry-Immunofluorescence-NBP2-36771-img0012.jpg "Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (CL2545) [NBP2-36771] - Staining in U2OS cell line with Anti-CS monoclonal antibody, showing specific mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody (CL2545) [NBP2-36771] - Staining of human skin shows granular cytoplasmic immunoreactivity in epithelial cells.](http://images.novusbio.com/fullsize/CS-Citrate-Synthase-Antibody-CL2545-Immunohistochemistry-NBP2-36771-img0001.jpg "Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody (CL2545) [NBP2-36771] - Staining of human skin shows granular cytoplasmic immunoreactivity in epithelial cells.")
![Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody (CL2545) [NBP2-36771] - Staining of human prostate shows strong granular cytoplasmic immunoreactivity in glandular cells.](http://images.novusbio.com/fullsize/CS-Citrate-Synthase-Antibody-CL2545-Immunohistochemistry-NBP2-36771-img0003.jpg "Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody (CL2545) [NBP2-36771] - Staining of human prostate shows strong granular cytoplasmic immunoreactivity in glandular cells.")
![Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody (CL2545) [NBP2-36771] - Staining of human placenta shows strong granular cytoplasmic positivity in the trophoblast.](http://images.novusbio.com/fullsize/CS-Citrate-Synthase-Antibody-CL2545-Immunohistochemistry-NBP2-36771-img0004.jpg "Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody (CL2545) [NBP2-36771] - Staining of human placenta shows strong granular cytoplasmic positivity in the trophoblast.")
![Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody (CL2545) [NBP2-36771] - Staining of human kidney shows strong granular cytoplasmic positivity in renal tubules.](http://images.novusbio.com/fullsize/CS-Citrate-Synthase-Antibody-CL2545-Immunohistochemistry-NBP2-36771-img0005.jpg "Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody (CL2545) [NBP2-36771] - Staining of human kidney shows strong granular cytoplasmic positivity in renal tubules.")
![Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody (CL2545) [NBP2-36771] - Staining of human colon shows granular cytoplasmic immunoreactivity in both glandular and lamina propria cells.](http://images.novusbio.com/fullsize/CS-Citrate-Synthase-Antibody-CL2545-Immunohistochemistry-NBP2-36771-img0006.jpg "Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody (CL2545) [NBP2-36771] - Staining of human colon shows granular cytoplasmic immunoreactivity in both glandular and lamina propria cells.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Immunocytochemistry Nucleostemin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nucleostemin_AF1638_Immunocytochemistry_6472.jpg)
![Simple Western Nucleostemin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nucleostemin_AF1638_Simple_Western_18959.jpg)
![Western Blot Nucleostemin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nucleostemin_AF1638_Western_Blot_18960.jpg)
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")