![Immunocytochemistry/Immunofluorescence: COX5b Antibody [NBP2-92927] - Analysis of C6 cells using COX5B antibody at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/COX5b-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-92927-img0010.jpg "Immunocytochemistry/Immunofluorescence: COX5b Antibody [NBP2-92927] - Analysis of C6 cells using COX5B antibody at dilution of 1:100. Blue: DAPI for nuclear staining.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IP |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 32-129 of human COX5B (NP_001853.2). ASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | COX5B |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 13 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS with 50% glycerol, pH7.3. |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for COX5b Antibody (NBP2-92927)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | COX5B |
![Immunohistochemistry-Paraffin: COX5b Antibody [NBP2-92927] - Rat kidney using COX5B Rabbit pAb at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/COX5b-Antibody-Immunohistochemistry-Paraffin-NBP2-92927-img0009.jpg "Immunohistochemistry-Paraffin: COX5b Antibody [NBP2-92927] - Rat kidney using COX5B Rabbit pAb at dilution of 1:100 (40x lens).")
![Western Blot: COX5b Antibody [NBP2-92927] - Analysis of 200ug extracts of HepG2 cells, using COX5b at a dilition of 1:1000.](http://images.novusbio.com/fullsize/COX5b-Antibody-Western-Blot-NBP2-92927-img0005.jpg "Western Blot: COX5b Antibody [NBP2-92927] - Analysis of 200ug extracts of HepG2 cells, using COX5b at a dilition of 1:1000.")
![Immunocytochemistry/Immunofluorescence: COX5b Antibody [NBP2-92927] - Analysis of NIH-3T3 cells using COX5b at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/COX5b-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-92927-img0001.jpg "Immunocytochemistry/Immunofluorescence: COX5b Antibody [NBP2-92927] - Analysis of NIH-3T3 cells using COX5b at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: COX5b Antibody [NBP2-92927] - Analysis of U-2 OS cells using COX5b at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/COX5b-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-92927-img0002.jpg "Immunocytochemistry/Immunofluorescence: COX5b Antibody [NBP2-92927] - Analysis of U-2 OS cells using COX5b at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: COX5b Antibody [NBP2-92927] - Human colon using COX5B Rabbit pAb at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/COX5b-Antibody-Immunohistochemistry-Paraffin-NBP2-92927-img0007.jpg "Immunohistochemistry-Paraffin: COX5b Antibody [NBP2-92927] - Human colon using COX5B Rabbit pAb at dilution of 1:100 (40x lens).")
![Immunohistochemistry-Paraffin: COX5b Antibody [NBP2-92927] - Mouse kidney using COX5B Rabbit pAb at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/COX5b-Antibody-Immunohistochemistry-Paraffin-NBP2-92927-img0008.jpg "Immunohistochemistry-Paraffin: COX5b Antibody [NBP2-92927] - Mouse kidney using COX5B Rabbit pAb at dilution of 1:100 (40x lens).")
![Western Blot: COX5b Antibody [NBP2-92927] - analysis of various lysates, using COX5B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.](http://images.novusbio.com/fullsize/nbp2-92927_rabbit-polyclonal-cox5b-antibody-western-blot-2592023124847..jpg "Western Blot: COX5b Antibody [NBP2-92927] - analysis of various lysates, using COX5B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.")
![COCO/DAND5 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "COCO/DAND5 [Unconjugated]")
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/DATA_PSG1_DPSG10_ELISA_797.jpg)
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/PSG-1_DPSG10_ELISA_164.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Immunohistochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Immunohistochemistry_21186.jpg)
![Western Blot Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Western_Blot_11656.jpg)
![Immunocytochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Immunocytochemistry_11911.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")