![Western Blot: COX4 Antibody (CL3515) [NBP2-61620] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line HeLaLane 3: Human cell line HEK 293Lane 4: Human cell line A-431Lane 5: Human cell line HepG2](http://images.novusbio.com/fullsize/COX4-Antibody-CL3515-Western-Blot-NBP2-61620-img0006.jpg "Western Blot: COX4 Antibody (CL3515) [NBP2-61620] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line HeLaLane 3: Human cell line HEK 293Lane 4: Human cell line A-431Lane 5: Human cell line HepG2")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clone | CL3515 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKT |
| Epitope | RDHPLPEVAH |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | COX4I1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for COX4 Antibody (NBP2-61620)Find related products by research area.
|
|
The Importance of the COX IV Antibody to Apoptosis Research COX IV isoform 1 is a nuclear-encoded polypeptide chain of the Cytochrome C Oxidase enzyme, located on the mitochondrial inner membrane. Owing to its widespread distribution in human and mammalian tissues, COX IV antibodies are widely used as loading ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | COX4I1 |
![Immunocytochemistry/Immunofluorescence: COX4 Antibody (CL3515) [NBP2-61620] - Staining of MCF7 cells using the Anti-COX4I1 monoclonal antibody, showing specific staining in mitochondria in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).](http://images.novusbio.com/fullsize/COX4-Antibody-CL3515-Immunocytochemistry-Immunofluorescence-NBP2-61620-img0007.jpg "Immunocytochemistry/Immunofluorescence: COX4 Antibody (CL3515) [NBP2-61620] - Staining of MCF7 cells using the Anti-COX4I1 monoclonal antibody, showing specific staining in mitochondria in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).")
![Immunohistochemistry-Paraffin: COX4 Antibody (CL3515) [NBP2-61620] - Staining of human skin shows strong cytoplasmic immunoreactivity in epithelial cells.](http://images.novusbio.com/fullsize/COX4-Antibody-CL3515-Immunohistochemistry-Paraffin-NBP2-61620-img0005.jpg "Immunohistochemistry-Paraffin: COX4 Antibody (CL3515) [NBP2-61620] - Staining of human skin shows strong cytoplasmic immunoreactivity in epithelial cells.")
![Immunohistochemistry: COX4 Antibody (CL3515) [NBP2-61620] - Staining of human prostate shows strong cytoplasmic immunoreactivity in epithelial cells.](http://images.novusbio.com/fullsize/COX4-Antibody-CL3515-Immunohistochemistry-NBP2-61620-img0001.jpg "Immunohistochemistry: COX4 Antibody (CL3515) [NBP2-61620] - Staining of human prostate shows strong cytoplasmic immunoreactivity in epithelial cells.")
![Immunohistochemistry: COX4 Antibody (CL3515) [NBP2-61620] - Staining of human placenta shows strong cytoplasmic immunoreactivity in trophoblasts.](http://images.novusbio.com/fullsize/COX4-Antibody-CL3515-Immunohistochemistry-NBP2-61620-img0002.jpg "Immunohistochemistry: COX4 Antibody (CL3515) [NBP2-61620] - Staining of human placenta shows strong cytoplasmic immunoreactivity in trophoblasts.")
![Immunohistochemistry: COX4 Antibody (CL3515) [NBP2-61620] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/COX4-Antibody-CL3515-Immunohistochemistry-NBP2-61620-img0003.jpg "Immunohistochemistry: COX4 Antibody (CL3515) [NBP2-61620] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry: COX4 Antibody (CL3515) [NBP2-61620] - Staining of human fallopian tube shows strong cytoplasmic immunoreactivity in epithelial cells.](http://images.novusbio.com/fullsize/COX4-Antibody-CL3515-Immunohistochemistry-NBP2-61620-img0004.jpg "Immunohistochemistry: COX4 Antibody (CL3515) [NBP2-61620] - Staining of human fallopian tube shows strong cytoplasmic immunoreactivity in epithelial cells.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")