![Western Blot: COX4 Antibody (1327) [NBP2-59777] - Analysis of extracts from U-251 cells, transfected with: control siRNA, target specific siRNA probe #1, target specific siRNA probe #2, using Anti-COX4I1 monoclonal antibody. Downregulation of antibody signal confirms target specificity. Remaining % intensity, relative control lane, is indicated. Anti-GAPDH monoclonal antibody was used as loading control.](http://images.novusbio.com/fullsize/COX4-Antibody-1327-Western-Blot-NBP2-59777-img0007.jpg "Western Blot: COX4 Antibody (1327) [NBP2-59777] - Analysis of extracts from U-251 cells, transfected with: control siRNA, target specific siRNA probe #1, target specific siRNA probe #2, using Anti-COX4I1 monoclonal antibody. Downregulation of antibody signal confirms target specificity. Remaining % intensity, relative control lane, is indicated. Anti-GAPDH monoclonal antibody was used as loading control.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, IHC, KD |
| Clone | CL3501 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKT |
| Epitope | EKVELYRIKFKESFA |
| Isotype | IgG2a |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | COX4I1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for COX4 Antibody (NBP2-59777)Find related products by research area.
|
|
The Importance of the COX IV Antibody to Apoptosis Research COX IV isoform 1 is a nuclear-encoded polypeptide chain of the Cytochrome C Oxidase enzyme, located on the mitochondrial inner membrane. Owing to its widespread distribution in human and mammalian tissues, COX IV antibodies are widely used as loading ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | COX4I1 |
![Immunohistochemistry-Paraffin: COX4 Antibody (1327) [NBP2-59777] - Staining of human liver shows cytoplasmic immunoreactivity in hepatocytes.](http://images.novusbio.com/fullsize/COX4-Antibody-1327-Immunohistochemistry-Paraffin-NBP2-59777-img0005.jpg "Immunohistochemistry-Paraffin: COX4 Antibody (1327) [NBP2-59777] - Staining of human liver shows cytoplasmic immunoreactivity in hepatocytes.")
![Western Blot: COX4 Antibody (1327) [NBP2-59777] - Analysis in human cell line HeLa, human cell line HEK 293, human cell line A-431, human cell line HepG2 and mouse cell line NIH-3T3.](http://images.novusbio.com/fullsize/COX4-Antibody-1327-Western-Blot-NBP2-59777-img0006.jpg "Western Blot: COX4 Antibody (1327) [NBP2-59777] - Analysis in human cell line HeLa, human cell line HEK 293, human cell line A-431, human cell line HepG2 and mouse cell line NIH-3T3.")
![Immunohistochemistry-Paraffin: COX4 Antibody (1327) [NBP2-59777] - Staining of human fallopian tube shows strong cytoplasmic immunoreactivity in epithelial cells.](http://images.novusbio.com/fullsize/COX4-Antibody-1327-Immunohistochemistry-Paraffin-NBP2-59777-img0001.jpg "Immunohistochemistry-Paraffin: COX4 Antibody (1327) [NBP2-59777] - Staining of human fallopian tube shows strong cytoplasmic immunoreactivity in epithelial cells.")
![Immunohistochemistry-Paraffin: COX4 Antibody (1327) [NBP2-59777] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules cells.](http://images.novusbio.com/fullsize/COX4-Antibody-1327-Immunohistochemistry-Paraffin-NBP2-59777-img0002.jpg "Immunohistochemistry-Paraffin: COX4 Antibody (1327) [NBP2-59777] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules cells.")
![Immunohistochemistry-Paraffin: COX4 Antibody (1327) [NBP2-59777] - Staining of human stomach shows strong cytoplasmic immunoreactivity in glandular epithelium cells.](http://images.novusbio.com/fullsize/COX4-Antibody-1327-Immunohistochemistry-Paraffin-NBP2-59777-img0003.jpg "Immunohistochemistry-Paraffin: COX4 Antibody (1327) [NBP2-59777] - Staining of human stomach shows strong cytoplasmic immunoreactivity in glandular epithelium cells.")
![Immunohistochemistry-Paraffin: COX4 Antibody (1327) [NBP2-59777] - Staining of human prostate shows cytoplasmic positivity in the epithelial cells.](http://images.novusbio.com/fullsize/COX4-Antibody-1327-Immunohistochemistry-Paraffin-NBP2-59777-img0004.jpg "Immunohistochemistry-Paraffin: COX4 Antibody (1327) [NBP2-59777] - Staining of human prostate shows cytoplasmic positivity in the epithelial cells.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
