Connexin 50/GJA8 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: VHYVRMEEKRKSREAEELGQQAGTNGGPDQGSVKKSSGSKGTKKFRLEGTLL |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
GJA8 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:2500 - 1:5000
- Immunohistochemistry-Paraffin 1:2500 - 1:5000
|
Application Notes |
Recommended conditions for IHC,Retrieval method: HIER pH6 |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Protein A purified |
Alternate Names for Connexin 50/GJA8 Antibody
Background
The 433 amino acid long, 48 kDA transmembrane connexin, gap junction alpha-8 protein encoded by the GJA8 gene is critical in growth and development of lens fiber cells. Mutations in the GJA8 gene may lead to zonular pulverulent cataracts, nuclear progressive cataracts, and cataract-microcornea syndrome. The GJA8 gene has been linked to myopia, microphthalmia, neuronitis, cycstic fibrosis, neuopathy, cervical adenocarcinoma, and juvenile myoclonic epilepsy. The GJA8 gene interacts with TJP1, MIP, MED14, GJA1, and GJB1 to participate in pathways such as gap junction assembly, membrane trafficking, and connexin synthesis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, WB
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, WB
Species: Mu
Applications: ICC/IF, WB
Species: Bv, Ca, Hu, Pm, Mu, Rb
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, MiAr, WB
Publications for Connexin 50/GJA8 Antibody (NBP2-68799) (0)
There are no publications for Connexin 50/GJA8 Antibody (NBP2-68799).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Connexin 50/GJA8 Antibody (NBP2-68799) (0)
There are no reviews for Connexin 50/GJA8 Antibody (NBP2-68799).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Connexin 50/GJA8 Antibody (NBP2-68799) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Connexin 50/GJA8 Products
Research Areas for Connexin 50/GJA8 Antibody (NBP2-68799)
Find related products by research area.
|
Blogs on Connexin 50/GJA8