Home » COL1A2 » COL1A2 Proteins » COL1A2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

COL1A2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for COL1A2 Recombinant Protein Antigen (NBP2-58529PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

COL1A2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human COL1A2.

Source: E. coli

Amino Acid Sequence: IKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYAS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
COL1A2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58529.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for COL1A2 Recombinant Protein Antigen

  • alpha 2(I)-collagen
  • Alpha-2 type I collagen
  • collagen alpha-2(I) chain
  • collagen I, alpha-2 polypeptide
  • collagen of skin, tendon and bone, alpha-2 chain
  • collagen, type I, alpha 2
  • OI4
  • osteogenesis imperfecta type IV
  • type I procollagen

Background

The extensive family of COL gene products (collagens) is composed of several chain types, including fibril-forming interstitial collagens (types I, II, III and V) and basement membrane collagens (type IV), each type containing multiple isoforms. Collagens are fibrous, extracellular matrix proteins with high tensile strength and are the major components of connective tissue, such as tendons and cartilage. All collagens contain a triple helix domain and frequently show lateral self-association in order to form complex connective tissues. Several collagens also play a role in cell adhesion, important for maintaining normal tissue architecture and function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Osteocalcin
Antibody (190125)
MAB1419
Intracellular Staining by Flow Cytometry Osteocalcin Antibody (190125)
Intracellular Staining by Flow Cytometry Osteocalcin Antibody (190125)
Immunocytochemistry Osteocalcin Antibody (190125)
(3 Reviews)
(54 Publications)
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
Collagen I Antibody
NB600-408
Immunohistochemistry-Paraffin Collagen I Antibody
Immunohistochemistry-Paraffin Collagen I Antibody
Immunohistochemistry-Paraffin Collagen I Antibody
(16 Reviews)
(298 Publications)
Species: Bv, Hu, Mu, Po, Rb, Rt
Applications: ELISA, FLISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, MiAr, PAGE, WB
PTH Antibody
(918462) [Unconjugate
MAB7665
Immunohistochemistry PTH Antibody (918462) [Unconjugated]
Western Blot PTH Antibody (918462) [Unconjugated]
Species: Hu
Applications: IHC, WB
Dystrophin Antibody
NBP1-89953
Immunohistochemistry-Paraffin Dystrophin Antibody
Immunohistochemistry-Paraffin Dystrophin Antibody
Immunohistochemistry-Paraffin Dystrophin Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Bestrophin 1
Antibody (E6-6) - BSA
NB300-164
Knockout Validated Bestrophin 1 Antibody (E6-6) - BSA Free
Immunohistochemistry-Paraffin Bestrophin 1 Antibody (E6-6) - BSA Free
Immunohistochemistry-Paraffin Bestrophin 1 Antibody (E6-6) - BSA Free
(1 Review)
(47 Publications)
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, PLA, WB
IGF-I/IGF-1
[Unconjugated]
291-G1
SDS-PAGE IGF-I/IGF-1 [Unconjugated]
Bioactivity IGF-I/IGF-1 [Unconjugated]
Mass Spectrometry IGF-I/IGF-1 [Unconjugated]
(217 Publications)
Species: Hu
Applications: BA
Fibronectin
Antibody - BSA Free
NBP1-91258
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
(11 Reviews)
(52 Publications)
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
MMP-1 Antibody
(36665) [Unconjugated
MAB901
Knockout Validated MMP-1 Antibody (36665) [Unconjugated]
Immunohistochemistry MMP-1 Antibody (36665) [Unconjugated]
Immunohistochemistry MMP-1 Antibody (36665) [Unconjugated]
(39 Publications)
Species: Hu
Applications: IHC, IP, KO, Neut, WB
Recombinant Human
PTRH1 GST (N-Term) Pr ...
H00138428-P01
Other Recombinant Human PTRH1 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
BMP-1/PCP Antibody
[Unconjugated]
AF1927
Western Blot BMP-1/PCP Antibody [Unconjugated]
Western Blot BMP-1/PCP Antibody [Unconjugated]
(10 Publications)
Species: Hu
Applications: IP, WB
CTGF/CCN2 Antibody
[Unconjugated] - C-te ...
AF660
Immunohistochemistry CTGF/CCN2 Antibody [Unconjugated] - C-terminus
Immunohistochemistry CTGF/CCN2 Antibody [Unconjugated] - C-terminus
Western Blot CTGF/CCN2 Antibody [Unconjugated] - C-terminus
(7 Publications)
Species: Hu
Applications: IHC
Collagen III alpha
1/COL3A1 Antibody
NB600-594
Immunohistochemistry Collagen III alpha 1/COL3A1 Antibody
Immunohistochemistry Collagen III alpha 1/COL3A1 Antibody
Western Blot Collagen III alpha 1/COL3A1 Antibody
(7 Reviews)
(44 Publications)
Species: Bv, Fe, Hu, Mu, Rt, Sh
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Elastin Antibody
(BA-4)
NB100-2076
Immunohistochemistry-Paraffin Elastin Antibody (BA-4)
Immunohistochemistry-Paraffin Elastin Antibody (BA-4)
Immunohistochemistry-Paraffin Elastin Antibody (BA-4)
(2 Reviews)
(11 Publications)
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Smad3 [p Ser423, p
Ser425] Antibody
NBP1-77836
Immunohistochemistry Smad3 [p Ser423, p Ser425] Antibody
Immunocytochemistry/ Immunofluorescence Smad3 [p Ser423, p Ser425] Antibody
Western Blot Smad3 [p Ser423, p Ser425] Antibody
(1 Review)
(12 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Alkaline
Phosphatase/ALPP Anti ...
NB110-3638
Immunocytochemistry/ Immunofluorescence Alkaline Phosphatase/ALPP Antibody (8B6) - BSA Free
Immunohistochemistry-Paraffin Alkaline Phosphatase/ALPP Antibody (8B6) - BSA Free
Western Blot Alkaline Phosphatase/ALPP Antibody (8B6) - BSA Free
(1 Review)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
Growth Hormone
Antibody [Unconjugate
AF1067
Western Blot Growth Hormone Antibody [Unconjugated]
ELISA Growth Hormone Antibody [Unconjugated]
Neutralization Growth Hormone Antibody [Unconjugated]
(15 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
ATRNL1 Antibody
NBP1-89131
Immunohistochemistry ATRNL1 Antibody
Immunocytochemistry/ Immunofluorescence ATRNL1 Antibody
Immunohistochemistry-Paraffin ATRNL1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
SLPI [HRP]
DPI00
N/A SLPI [HRP]
N/A SLPI [HRP]
(36 Publications)
Species: Hu
Applications: ELISA
CCL27/CTACK [HRP]
DCC270
N/A CCL27/CTACK [HRP]
N/A CCL27/CTACK [HRP]
(10 Publications)
Species: Hu
Applications: ELISA
COL1A2 Recombinant
Protein Antigen
NBP2-58529PEP
COL1A2 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for COL1A2 Recombinant Protein Antigen (NBP2-58529PEP) (0)

There are no publications for COL1A2 Recombinant Protein Antigen (NBP2-58529PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COL1A2 Recombinant Protein Antigen (NBP2-58529PEP) (0)

There are no reviews for COL1A2 Recombinant Protein Antigen (NBP2-58529PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for COL1A2 Recombinant Protein Antigen (NBP2-58529PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional COL1A2 Products

Research Areas for COL1A2 Recombinant Protein Antigen (NBP2-58529PEP)

Find related products by research area.

Blogs on COL1A2

There are no specific blogs for COL1A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Balb/3T3 mouse embryonic fibroblast cell line stained with Collagen I antibody. IHC-P image submitted by a verified customer review.
Collagen I Antibody
NB600-408-0.1mg

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our COL1A2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol COL1A2