Home » COG8 » COG8 Proteins » Recombinant Human COG8 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human COG8 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human COG8 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-219 of Human COG8

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MNSYMLISAPAILGTSNMPAAVPATQPGTLQPPMVLLDFPPLACFLNNILVAFNDLRLCCPVALAQDVTGALEDALAKVTKIILAFHRAEEAAFSSGEQELFVQFCTVFLEDLVPYLNRCLQVLFPPAQIAQTLGIPPTQLSKYGNLGHVNIGAIQEPLAFILPKRETLFTLDDQALGPELTAPAPEPPAEEPRLEPAGPACPEGGRAETQAEPPSVGP
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
COG8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
49.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human COG8 GST (N-Term) Protein

  • COG complex subunit 8
  • component of oligomeric golgi complex 8CDG2H
  • conserved oligomeric Golgi complex subunit 8
  • dependent on RIC1
  • DOR1conserved oligomeric golgi complex component 8
  • FLJ22315

Background

This gene encodes a protein that is a component of the conserved oligomeric Golgi (COG) complex, a multiprotein complex that plays a structural role in the Golgi apparatus, and is involved in intracellular membrane trafficking and glycoprotein modification. Mutations in this gene cause congenital disorder of glycosylation, type IIh, a disease that is characterized by under-glycosylated serum proteins, and whose symptoms include severe psychomotor retardation, failure to thrive, seizures, and dairy and wheat product intolerance. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

mu Opioid R/OPRM1
Antibody
NBP1-31180
Immunohistochemistry-Paraffin mu Opioid R/OPRM1 Antibody
Western Blot mu Opioid R/OPRM1 Antibody
Immunocytochemistry/ Immunofluorescence mu Opioid R/OPRM1 Antibody
(1 Review)
(5 Publications)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MDH2 Antibody
NBP1-86036
Immunohistochemistry-Paraffin MDH2 Antibody
Immunohistochemistry-Paraffin MDH2 Antibody
Immunohistochemistry-Paraffin MDH2 Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
COG1 Antibody -
Azide and BSA Free
NBP3-15543
Immunohistochemistry-Paraffin COG1 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin COG1 Antibody - Azide and BSA Free
Western Blot COG1 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
COG2 Antibody
NBP3-38235
Immunohistochemistry COG2 Antibody
Immunohistochemistry COG2 Antibody
Western Blot COG2 Antibody
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
COG3 Antibody
NBP2-15937
Western Blot COG3 Antibody
Western Blot COG3 Antibody
Immunohistochemistry-Paraffin COG3 Antibody
Species: Hu, Mu
Applications: IHC, IHC-P, WB
COP9 Antibody
NBP1-85435
Immunohistochemistry-Paraffin COP9 Antibody
Western Blot COP9 Antibody
Western Blot COP9 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
COG4 Antibody
NBP2-30718
Immunohistochemistry-Paraffin COG4 Antibody
Immunocytochemistry/ Immunofluorescence COG4 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
COG7 Antibody
NBP1-05032
Western Blot COG7 Antibody
Immunohistochemistry-Paraffin COG7 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
POMC Antibody
NB100-1533
Flow Cytometry POMC Antibody
Immunohistochemistry POMC Antibody
Immunohistochemistry POMC Antibody
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
COG5 Antibody
NBP1-93713
Immunocytochemistry/ Immunofluorescence COG5 Antibody
Immunohistochemistry-Paraffin COG5 Antibody
Immunohistochemistry-Paraffin COG5 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PAG1 Antibody
(504004) [Unconjugate
MAB5285
Simple Western PAG1 Antibody (504004) [Unconjugated]
Western Blot PAG1 Antibody (504004) [Unconjugated]
(1 Publication)
Species: Hu
Applications: Simple Western, WB
PYK2/FAK2 Antibody
NBP3-12969
Western Blot PYK2/FAK2 Antibody
Immunocytochemistry/ Immunofluorescence PYK2/FAK2 Antibody
Immunoprecipitation PYK2/FAK2 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
GDF-15 [HRP]
DGD150
N/A GDF-15 [HRP]
N/A GDF-15 [HRP]
N/A GDF-15 [HRP]
(98 Publications)
Species: Hu
Applications: ELISA
PFDN1 Antibody
NBP1-87294
Immunocytochemistry/ Immunofluorescence PFDN1 Antibody
Immunohistochemistry-Paraffin PFDN1 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Peroxiredoxin 1
Antibody
NBP1-82558
Immunohistochemistry-Paraffin Peroxiredoxin 1 Antibody
Immunohistochemistry-Paraffin Peroxiredoxin 1 Antibody
Immunohistochemistry-Paraffin Peroxiredoxin 1 Antibody
(8 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PDF Antibody
(OTI3F3) - Azide and ...
NBP2-73301
Western Blot PDF Antibody (OTI3F3) - Azide and BSA Free
Flow Cytometry PDF Antibody (OTI3F3) - Azide and BSA Free
Flow Cytometry PDF Antibody (OTI3F3) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, WB
BBS9 Antibody
NBP1-88927
Immunohistochemistry-Paraffin BBS9 Antibody
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Opsin 1 (Long
Wave) Antibody
NBP3-09392
Western Blot Opsin 1 (Long Wave) Antibody
Species: Hu, Mu
Applications: WB
Recombinant Human
COG8 GST (N-Term) Pro ...
H00084342-P01
Recombinant Human COG8 GST (N-Term) Protein
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for COG8 Recombinant Protein (H00084342-P01) (0)

There are no publications for COG8 Recombinant Protein (H00084342-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COG8 Recombinant Protein (H00084342-P01) (0)

There are no reviews for COG8 Recombinant Protein (H00084342-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COG8 Recombinant Protein (H00084342-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional COG8 Products

Blogs on COG8

There are no specific blogs for COG8, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human COG8 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol COG8