![Immunocytochemistry/Immunofluorescence: COG5 Antibody [NBP1-93713] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.](http://images.novusbio.com/fullsize/COG5-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-93713-img0004.jpg "Immunocytochemistry/Immunofluorescence: COG5 Antibody [NBP1-93713] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SFWTNMEKLMDHIYAVCGQVQHLQKVLAKKRDPVSHICFIEEIVKDGQPEIFYTFWNSVTQALSSQFHMATNSSMFLKQAFEGEYPKLLRLYNDLWKRLQQYSQHIQGNFNASGTTDLYVD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | COG5 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Intracellular Staining by Flow Cytometry GPR22 Antibody (455108) [Unconjugated]](https://images.novusbio.com/images2/GPR22_MAB4500_Flow_Cytometry_8467.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | COG5 |
![Immunohistochemistry-Paraffin: COG5 Antibody [NBP1-93713] - Staining of human Liver shows strong granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/COG5-Antibody-Immunohistochemistry-Paraffin-NBP1-93713-img0007.jpg "Immunohistochemistry-Paraffin: COG5 Antibody [NBP1-93713] - Staining of human Liver shows strong granular cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: COG5 Antibody [NBP1-93713] - Staining of human colon shows strong cytoplasmic positivity in granular pattern in glandular cells.](http://images.novusbio.com/fullsize/COG5-Antibody-Immunohistochemistry-Paraffin-NBP1-93713-img0002.jpg "Immunohistochemistry-Paraffin: COG5 Antibody [NBP1-93713] - Staining of human colon shows strong cytoplasmic positivity in granular pattern in glandular cells.")
![Immunohistochemistry-Paraffin: COG5 Antibody [NBP1-93713] - Staining of human Cervix shows moderate granular cytoplasmic positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/COG5-Antibody-Immunohistochemistry-Paraffin-NBP1-93713-img0005.jpg "Immunohistochemistry-Paraffin: COG5 Antibody [NBP1-93713] - Staining of human Cervix shows moderate granular cytoplasmic positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: COG5 Antibody [NBP1-93713] - Staining of human Duodenum shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/COG5-Antibody-Immunohistochemistry-Paraffin-NBP1-93713-img0006.jpg "Immunohistochemistry-Paraffin: COG5 Antibody [NBP1-93713] - Staining of human Duodenum shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: COG5 Antibody [NBP1-93713] - Staining of human Lymph node shows strong granular cytoplasmic positivity in germinal and non-germinal center cells.](http://images.novusbio.com/fullsize/COG5-Antibody-Immunohistochemistry-Paraffin-NBP1-93713-img0008.jpg "Immunohistochemistry-Paraffin: COG5 Antibody [NBP1-93713] - Staining of human Lymph node shows strong granular cytoplasmic positivity in germinal and non-germinal center cells.")
![N/A IL-1ra/IL-1F3/IL1RN [HRP]](https://images.novusbio.com/images2/IL-1ra_DRA00_ELISA_392.jpg)
![N/A IL-1ra/IL-1F3/IL1RN [HRP]](https://images.novusbio.com/images2/DATA_IL1ra_DRA00_ELISA_802.jpg)
![N/A IL-1ra/IL-1F3/IL1RN [HRP]](https://images.novusbio.com/images2/DATA_IL1ra_DRA00_ELISA_803.jpg)
![Immunohistochemistry GDF-5/BMP-14 Antibody [Unconjugated]](https://images.novusbio.com/images2/GDF-5_AF853_Immunohistochemistry_6908.jpg)
![Western Blot GDF-5/BMP-14 Antibody [Unconjugated]](https://images.novusbio.com/images2/af853_mouse-gdf-5-affinity-purified-polyclonal-ab-western-blot-25102022133916.jpg)
![Simple Western HMGA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/HMGA2_AF3184_Simple_Western_16679.jpg)
![Western Blot HMGA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/HMGA2_AF3184_Western_Blot_7403.jpg)
![Immunocytochemistry HMGA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/af3184_human-mouse-hmga2-affinity-purified-polyclonal-ab-immunocytochemistry-4122020143513.jpg)
![Immunohistochemistry Desmin Antibody [Unconjugated]](https://images.novusbio.com/images2/Desmin_AF3844_Immunohistochemistry_10689.jpg)
![Immunohistochemistry Desmin Antibody [Unconjugated]](https://images.novusbio.com/images2/Desmin_AF3844_Immunohistochemistry_6808.jpg)
![Immunocytochemistry/ Immunofluorescence Desmin Antibody [Unconjugated]](https://images.novusbio.com/images/af3844_human-mouse-desmin-affinity-purified-polyclonal-ab-41202410331920.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")