Home » CLEC16A » CLEC16A Proteins » CLEC16A Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

CLEC16A Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CLEC16A Recombinant Protein Antigen (NBP2-57150PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CLEC16A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CLEC16A.

Source: E. coli

Amino Acid Sequence: EPETQLPLTREEDLIKTDDVLDLNNSDLIACTVITKDGGMVQRFLAVDIYQMSLVEPDVSRLGWGVVKFAGLLQDMQVTGVEDDSRALNITIHKP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CLEC16A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57150.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CLEC16A Recombinant Protein Antigen

  • CLEC16A
  • C-type lectin domain family 16, member A
  • Gop-1
  • KIAA0350
  • KIAA0350Gop-1
  • MGC111457
  • protein CLEC16A

Background

CLEC16A is almost exclusively expressed in immune cells, including dendritic cells, B lymphocytes and natural killer cells. There are three isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CD25/IL-2R alpha
[HRP]
DR2A00
N/A CD25/IL-2R alpha [HRP]
N/A CD25/IL-2R alpha [HRP]
(36 Publications)
Species: Hu
Applications: ELISA
IL-7R alpha/CD127
Antibody (R34-34)
DDX0700P-100
Immunoprecipitation IL-7R alpha/CD127 Antibody (R34-34)
Flow Cytometry IL-7R alpha/CD127 Antibody (R34-34)
Flow Cytometry IL-7R alpha/CD127 Antibody (R34-34)
(40 Publications)
Species: Ca, Hu
Applications: B/N, Flow, IP
CIITA Antibody -
BSA Free
NBP2-59072
Immunohistochemistry-Paraffin CIITA Antibody - BSA Free
Western Blot CIITA Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CIITA Antibody - BSA Free
(2 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
ErbB3/Her3
Antibody (66223) [Unc ...
MAB3481
Neutralization ErbB3/Her3 Antibody (66223) [Unconjugated]
(21 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, Neut
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
MDA5 Antibody
NB110-1244
Immunohistochemistry-Paraffin MDA5 Antibody
Flow Cytometry MDA5 Antibody
(8 Publications)
Species: Hu, Mu, Pm
Applications: Flow, IHC, IHC-P, PEP-ELISA
CD58/LFA-3
Antibody (TS2/9) - Az ...
NBP2-22542
Flow Cytometry CD58/LFA-3 Antibody (TS2/9) - Azide and BSA Free
Flow Cytometry CD58/LFA-3 Antibody (TS2/9) - Azide and BSA Free
Flow Cytometry CD58/LFA-3 Antibody (TS2/9) - Azide and BSA Free
(1 Publication)
Species: Hu
Applications: B/N, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IP, WB
LNK/SH2B3 Antibody
(OTI2D8)
NBP2-00641
Flow Cytometry LNK/SH2B3 Antibody (OTI2D8)
Flow Cytometry LNK/SH2B3 Antibody (OTI2D8)
Western Blot LNK/SH2B3 Antibody (OTI2D8)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(377 Publications)
Species: Hu
Applications: BA
Lyp/PTPN22
Antibody [Unconjugate
AF3428
Western Blot Lyp/PTPN22 Antibody [Unconjugated]
Simple Western Lyp/PTPN22 Antibody [Unconjugated]
Immunocytochemistry Lyp/PTPN22 Antibody [Unconjugated]
(9 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
DNAM-1/CD226
Antibody (102511) [Un ...
MAB666
Flow Cytometry DNAM-1/CD226 Antibody (102511) [Unconjugated]
Neutralization DNAM-1/CD226 Antibody (102511) [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
Recombinant Human
HLA DRB4 GST (N-Term) ...
H00003126-P01
Other Recombinant Human HLA DRB4 GST (N-Term) Protein
(1 Publication)
Species: Hu
Applications: ELISA, AP, PA, WB
IL-13 [Biotin]
DY413
N/A IL-13 [Biotin]
(147 Publications)
Species: Mu
Applications: ELISA
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
SOCS-1 Antibody
NB100-56637
Western Blot SOCS-1 Antibody
(1 Review)
(5 Publications)
Species: Hu, Mu
Applications: WB
TC-PTP/PTPN2
Antibody (252294) [Un ...
MAB1930
Western Blot TC-PTP/PTPN2 Antibody (252294) [Unconjugated]
Western Blot TC-PTP/PTPN2 Antibody (252294) [Unconjugated]
Western Blot TC-PTP/PTPN2 Antibody (252294) [Unconjugated]
(7 Publications)
Species: Hu, Mu, Rt
Applications: WB
EVI5 Antibody
NBP1-82596
Immunocytochemistry/ Immunofluorescence EVI5 Antibody
Immunohistochemistry-Paraffin EVI5 Antibody
Immunohistochemistry-Paraffin EVI5 Antibody
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
RPL5 Antibody
NBP1-31413
Immunocytochemistry/ Immunofluorescence RPL5 Antibody
Knockdown Validated RPL5 Antibody
Immunohistochemistry-Paraffin RPL5 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
MHC Class I
Antibody (OX18) - BSA
NB120-6405
Flow Cytometry MHC Class I Antibody (OX18) - BSA Free
Immunocytochemistry/ Immunofluorescence MHC Class I Antibody (OX18) - BSA Free
Immunocytochemistry/ Immunofluorescence MHC Class I Antibody (OX18) - BSA Free
(33 Publications)
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for CLEC16A Recombinant Protein Antigen (NBP2-57150PEP) (0)

There are no publications for CLEC16A Recombinant Protein Antigen (NBP2-57150PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLEC16A Recombinant Protein Antigen (NBP2-57150PEP) (0)

There are no reviews for CLEC16A Recombinant Protein Antigen (NBP2-57150PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CLEC16A Recombinant Protein Antigen (NBP2-57150PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CLEC16A Products

Array NBP2-57150PEP

Research Areas for CLEC16A Recombinant Protein Antigen (NBP2-57150PEP)

Find related products by research area.

Blogs on CLEC16A

There are no specific blogs for CLEC16A, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

As an alternative, please consider our next generation Recombinant Human IL-2 (BT-002). It has equivalent bioactivity to Recombinant Human IL-2 (Catalog # 202-IL). It combines R&D Systems quality with scalability that allows for a solid supply chain. Both Recombinant Human IL-2 proteins are measured in a cell proliferation assay using CTLL 2 mouse cytotoxic T cells.
IL-2 [Unconjugated]
202-IL-010

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CLEC16A Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CLEC16A