![Western Blot: Claudin-15 Antibody [H00024146-B02P] - Analysis of CLDN15 expression in transfected 293T cell line by CLDN15 polyclonal antibody. Lane1:CLDN15 transfected lysate(25.08 KDa). Lane2:Non-transfected lysate.](http://images.novusbio.com/fullsize/Claudin-15-Antibody-Western-Blot-H00024146-B02P-img0002.jpg "Western Blot: Claudin-15 Antibody [H00024146-B02P] - Analysis of CLDN15 expression in transfected 293T cell line by CLDN15 polyclonal antibody. Lane1:CLDN15 transfected lysate(25.08 KDa). Lane2:Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | CLDN15 (NP_055158.1, 1 a.a. - 228 a.a.) full-length human protein. MSMAVETFGFFMATVGLLMLGVTLPNSYWRVSTVHGNVITTNTIFENLWFSCATDSLGVYNCWEFPSMLALSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATAGALHILAGICGMVAISWYAFNITRDFFDPLYPGTKYELGPALYLGWSASLISILGGLCLCSACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV |
| Specificity | CLDN15 - claudin 15, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | CLDN15 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
![Neutralization Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Block_Neutralize_8779.jpg)
![Western Blot Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Western_Blot_20179.jpg)
![Immunohistochemistry Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1445_mouse-rat-prolactin-affinity-purified-polyclonal-ab-immunohistochemistry-19202393922..jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CLDN15 |
| Entrez |
|
| Uniprot |
|
![Flow Cytometry Claudin-4 Antibody (382321) [Unconjugated]](https://images.novusbio.com/images2/Claudin4_MAB4219_Flow_Cytometry_21352.jpg)
![Immunocytochemistry Claudin-6 Antibody (342927) [Unconjugated]](https://images.novusbio.com/images2/Claudin6_MAB3656_Immunocytochemistry_15896.jpg)
![Flow Cytometry Claudin-6 Antibody (342927) [Unconjugated]](https://images.novusbio.com/images2/Claudin6_MAB3656_Flow_Cytometry_22547.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")