Home » Chk2 » Chk2 Proteins » Chk2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Chk2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Chk2 Recombinant Protein Antigen (NBP2-88933PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Chk2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Chk2.

Source: E. coli

Amino Acid Sequence: TSTMPNSSQSSHSSSGTLSSLETVSTQELYSIPEDQEPEDQEPEEPTPAPWARLWALQDGFANLECVNDNYWFGRDKSCEYCFDEPLLKRTDKYRTYSKKHFRIFREVGPKNSYIAYIEDHSGNG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G).

Source: E. coli

Amino Acid Sequence: TSTMPNSSQSSHSSSGTLSSLETVSTQELYSIPEDQEPEDQEPEEPTPAPWARLWALQDGFANLECVNDNYWFGRDKSCEYCFDEPLLKRTDKYRTYSKKHFRIFREVGPKNSYIAYIEDHSGNG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CHEK2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-88933.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS, 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80%, by SDS-PAGE

Alternate Names for Chk2 Recombinant Protein Antigen

  • CDS1
  • CHEK2
  • CHK2 checkpoint homolog (S. pombe)
  • Chk2
  • EC 2.7.11
  • EC 2.7.11.1
  • HuCds1
  • LFS2
  • PP1425
  • Rad53
  • S.pombe) homolog

Background

Cell cycle events are regulated by the sequential activation and deactivation of cyclin dependent kinases (Cdks) and by proteolysis of cyclins. Chk1 and Chk2 are involved in these processes as regulators of Cdks. Chk1 and Chk2 both function as essential components in the G2 DNA damage checkpoint by phosphorylating Cdc25C in response to DNA damage. Phosphorylation inhibits Cdc25C activity, thereby blocking mitosis. Cdc25A, Cdc25B and Cdc25C protein tyrosine phosphatases function as mitotic activators by dephosphorylating Cdc2 p34 on regulatory tyrosine residues. It has also been shown that Chk1 can phosphorylate Wee1 in vitro, providing evidence that the hyperphosphorylated form of Wee1, seen in cells delayed by Chk1 over expression, is due to phosphorylation by Chk1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Chk1 Antibody
NB100-464
Immunoprecipitation Chk1 Antibody
Immunohistochemistry-Paraffin Chk1 Antibody
Western Blot Chk1 Antibody
(12 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
ATM Antibody (2C1)
NB100-309
Knockdown Validated ATM Antibody (2C1)
Knockdown Validated ATM Antibody (2C1)
Immunoprecipitation ATM Antibody (2C1)
(3 Reviews)
(131 Publications)
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
ATR Antibody (2B5)
NB100-308
Immunocytochemistry/ Immunofluorescence ATR Antibody (2B5)
Western Blot ATR Antibody (2B5)
Western Blot ATR Antibody (2B5)
(21 Publications)
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
MMAB Antibody
(OTI2G5)
NBP2-03417
Flow Cytometry MMAB Antibody (OTI2G5)
Flow Cytometry MMAB Antibody (OTI2G5)
Western Blot MMAB Antibody (OTI2G5)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
TEM8/ANTXR1
Antibody (200C1339(SB ...
NB100-56585
Immunohistochemistry-Paraffin TEM8/ANTXR1 Antibody (200C1339(SB20)) - BSA Free
Immunohistochemistry-Paraffin TEM8/ANTXR1 Antibody (200C1339(SB20)) - BSA Free
Western Blot TEM8/ANTXR1 Antibody (200C1339(SB20)) - BSA Free
(5 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Histone H2AX [p
Ser139] Antibody [Unc ...
AF2288
Western Blot Histone H2AX [p Ser139] Antibody [Unconjugated]
Simple Western Histone H2AX [p Ser139] Antibody [Unconjugated]
Immunocytochemistry Histone H2AX [p Ser139] Antibody [Unconjugated]
(25 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
BRCA1 Antibody
(RAY) - BSA Free
NB100-598
Western Blot BRCA1 Antibody (RAY) - BSA Free
Immunocytochemistry/ Immunofluorescence BRCA1 Antibody (RAY) - BSA Free
Flow Cytometry BRCA1 Antibody (RAY) - BSA Free
(6 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
Nbs1 Antibody
NB100-143
Knockout Validated Nbs1 Antibody
Western Blot Nbs1 Antibody
Knockdown Validated Nbs1 Antibody
(8 Reviews)
(204 Publications)
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, ISH, KD, KO, PAGE, WB
CDC25C Antibody
(461908) [Unconjugate
MAB4459
Western Blot CDC25C Antibody (461908) [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB
CDC2/CDK1 Antibody
NBP1-85729
Immunohistochemistry-Paraffin CDC2/CDK1 Antibody
Western Blot CDC2/CDK1 Antibody
Western Blot CDC2/CDK1 Antibody
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
BRCA2 Antibody
(234403) [Unconjugate
MAB2476
Western Blot BRCA2 Antibody (234403) [Unconjugated]
Immunohistochemistry BRCA2 Antibody (234403) [Unconjugated]
Western Blot BRCA2 Antibody (234403) [Unconjugated]
(13 Publications)
Species: Hu
Applications: IHC, WB
TCEAL1 Antibody
(OTI2G10)
NBP2-46085
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Species: Hu
Applications: IHC, IHC-P, WB
D4S234E Antibody
(1C3)
H00027065-M01
Sandwich ELISA D4S234E Antibody (1C3)
Western Blot D4S234E Antibody (1C3)
Western Blot D4S234E Antibody (1C3)
(1 Publication)
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
CDC25A Antibody
(336445)
MAB1648
Western Blot CDC25A Antibody (336445)
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, WB
NLRP2/NALP2
Antibody
NB100-56155
Immunohistochemistry-Paraffin NLRP2/NALP2 Antibody
Western Blot NLRP2/NALP2 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, IP, WB
DNA Polymerase
delta, catalytic subu ...
NBP2-33466
Immunohistochemistry-Paraffin DNA Polymerase delta, catalytic subunit Antibody
Immunohistochemistry-Paraffin DNA Polymerase delta, catalytic subunit Antibody
Immunohistochemistry-Paraffin DNA Polymerase delta, catalytic subunit Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Rad9 Antibody
(93A535) - BSA Free
NB120-13600
Western Blot Rad9 Antibody (93A535) - BSA Free
Immunohistochemistry-Paraffin Rad9 Antibody (93A535) - BSA Free
(8 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Chk2 Recombinant
Protein Antigen
NBP2-88933PEP
Chk2 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Chk2 Recombinant Protein Antigen (NBP2-88933PEP) (0)

There are no publications for Chk2 Recombinant Protein Antigen (NBP2-88933PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Chk2 Recombinant Protein Antigen (NBP2-88933PEP) (0)

There are no reviews for Chk2 Recombinant Protein Antigen (NBP2-88933PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Chk2 Recombinant Protein Antigen (NBP2-88933PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Chk2 Products

Research Areas for Chk2 Recombinant Protein Antigen (NBP2-88933PEP)

Find related products by research area.

Blogs on Chk2

There are no specific blogs for Chk2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Knockout Validated: Nbs1 Antibody [NB100-143] - Lysates of HeLa human cervical epithelial carcinoma parental cell line and Nbs1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Rabbit Anti-Human Polyclonal [NB100-143] followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (HAF008). Specific band was detected for Nbs1 at approximately 95 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Nbs1 Antibody
NB100-143
Knockdown Validated: ATM Antibody (2C1) [NB100-309] - Non-transfected (-) and transfected (+) HeLa whole cell extracts (60 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with ATM antibody (2C1) [NB100-309] diluted at 1:500.
ATM Antibody (2C1)
NB100-309

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Chk2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CHEK2