ChemR23/CMKLR1 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the amino acids: QDFKKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMNERTSMNERETG |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CMKLR1 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Publications |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (82%)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for ChemR23/CMKLR1 Antibody
Background
Chemokine-Like Receptor 1 (CMKLR1) is an chemoattractant receptor. CMKLR1 is thought to act primarily in bone development where it is differentially regulated in osseous and cartilaginous tissue. It also acts as a coreceptor for immunodeficiency viruses. CMKLR1 has two variants that are produced by alternative splicing. Chemokine-like receptor 1 (CMKLR1) has been reported to be expressed in bone marrow, liver, appendix, thymus, lymph node, placenta, and spleen. ESTs have been isolated from human normal kidney and testis libraries and from a prostate cancer library.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: Neut, WB
Species: Hu
Applications: BA
Species: Mu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Mu
Applications: CyTOF-ready, Flow, ICC
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Pm
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Publications for ChemR23/CMKLR1 Antibody (NBP2-13847)(1)
Showing Publication 1 -
1 of 1.
Reviews for ChemR23/CMKLR1 Antibody (NBP2-13847) (0)
There are no reviews for ChemR23/CMKLR1 Antibody (NBP2-13847).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for ChemR23/CMKLR1 Antibody (NBP2-13847) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ChemR23/CMKLR1 Products
Research Areas for ChemR23/CMKLR1 Antibody (NBP2-13847)
Find related products by research area.
|
Blogs on ChemR23/CMKLR1