![Immunocytochemistry/Immunofluorescence: CHD1 Antibody [NBP2-14478] - Staining of human cell line RH-30 shows localization to nucleus & nucleoli fibrillar center. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CHD1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14478-img0003.jpg "Immunocytochemistry/Immunofluorescence: CHD1 Antibody [NBP2-14478] - Staining of human cell line RH-30 shows localization to nucleus & nucleoli fibrillar center. Antibody staining is shown in green.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: QESQQNSDQNSNLNPHVIRNPDVERLKENTNHDDSSRDSYSSDRHLTQYHDHHKDRHQGDSYKKSDSRKRPYSSFSNGKDHRDWDHYKQDSRYYSDREKHRKLDDHRSRDHRSNLEGSL |
| Predicted Species | Mouse (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CHD1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for CHD1 Antibody (NBP2-14478)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CHD1 |
![Immunohistochemistry-Paraffin: CHD1 Antibody [NBP2-14478] - Staining in human testis and skeletal muscle tissues.. Corresponding CHD1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/CHD1-Antibody-Immunohistochemistry-Paraffin-NBP2-14478-img0010.jpg "Immunohistochemistry-Paraffin: CHD1 Antibody [NBP2-14478] - Staining in human testis and skeletal muscle tissues.. Corresponding CHD1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: CHD1 Antibody [NBP2-14478] - Staining of human placenta shows moderate to strong nuclear positivity.](http://images.novusbio.com/fullsize/CHD1-Antibody-Immunohistochemistry-Paraffin-NBP2-14478-img0005.jpg "Immunohistochemistry-Paraffin: CHD1 Antibody [NBP2-14478] - Staining of human placenta shows moderate to strong nuclear positivity.")
![Immunohistochemistry-Paraffin: CHD1 Antibody [NBP2-14478] - Staining of human endometrium shows weak to moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/CHD1-Antibody-Immunohistochemistry-Paraffin-NBP2-14478-img0006.jpg "Immunohistochemistry-Paraffin: CHD1 Antibody [NBP2-14478] - Staining of human endometrium shows weak to moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: CHD1 Antibody [NBP2-14478] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/CHD1-Antibody-Immunohistochemistry-Paraffin-NBP2-14478-img0007.jpg "Immunohistochemistry-Paraffin: CHD1 Antibody [NBP2-14478] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: CHD1 Antibody [NBP2-14478] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/CHD1-Antibody-Immunohistochemistry-Paraffin-NBP2-14478-img0008.jpg "Immunohistochemistry-Paraffin: CHD1 Antibody [NBP2-14478] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.")
![Western Blot Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Western_Blot_5829.jpg)
![Immunocytochemistry Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Immunocytochemistry_11663.jpg)
![Immunocytochemistry Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Immunocytochemistry_11664.jpg)
![Western Blot DSCAM Antibody [Unconjugated] - Long Isoform](https://images.novusbio.com/images2/DSCAM_AF3666_Western_Blot_21015.jpg)
![Immunocytochemistry DSCAM Antibody [Unconjugated] - Long Isoform](https://images.novusbio.com/images2/DSCAM_AF3666_Immunocytochemistry_6499.jpg)
![Western Blot DSCAM Antibody [Unconjugated] - Long Isoform](https://images.novusbio.com/images/af3666_human-dscam-affinity-purified-polyclonal-ab-22820241721154.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")