![Western Blot: CHD3 Antibody (8Z6L6) [NBP3-16632] - Western blot analysis of extracts of Mouse brain, using CHD3 Rabbit mAb (NBP3-16632) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.](http://images.novusbio.com/fullsize/CHD3-Antibody-8Z6L6-Western-Blot-NBP3-16632-img0006.jpg "Western Blot: CHD3 Antibody (8Z6L6) [NBP3-16632] - Western blot analysis of extracts of Mouse brain, using CHD3 Rabbit mAb (NBP3-16632) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clone | 8Z6L6 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CHD3 (Q12873). MKAADTVILWARSKNDQLRISFPPGLCWGDRMPDKDDIRLLPSALGVKKRKRGPKKQKENKPGKPRKRKKRDSEEEFGSERDEYREKSESGGSEYGTGPG |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | CHD3 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunohistochemistry-Paraffin KAP1 [p Ser824] Antibody](https://images.novusbio.com/images/KAP1-[p-Ser824]-Antibody-Immunohistochemistry-Paraffin-NB100-2350-img0013.jpg)
![Immunohistochemistry-Paraffin KAP1 [p Ser824] Antibody](https://images.novusbio.com/images/KAP1-[p-Ser824]-Antibody-Immunohistochemistry-Paraffin-NB100-2350-img0014.jpg)
![Immunocytochemistry/ Immunofluorescence KAP1 [p Ser824] Antibody](https://images.novusbio.com/images/KAP1-[p-Ser824]-Antibody-Immunocytochemistry-Immunofluorescence-NB100-2350-img0015.jpg)
![Western Blot PKLR Antibody [Unconjugated]](https://images.novusbio.com/images2/PKLR_AF8519_Western_Blot_16592.jpg)
![Simple Western PKLR Antibody [Unconjugated]](https://images.novusbio.com/images2/af8519_human-mouse-rat-pklr-affinity-purified-pab-simple-western-1342022154119.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for CHD3 Antibody (NBP3-16632)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CHD3 |
![Western Blot: CHD3 Antibody (8Z6L6) [NBP3-16632] - Western blot analysis of extracts of various cell lines, using CHD3 Rabbit mAb (NBP3-16632) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.](http://images.novusbio.com/fullsize/CHD3-Antibody-8Z6L6-Western-Blot-NBP3-16632-img0005.jpg "Western Blot: CHD3 Antibody (8Z6L6) [NBP3-16632] - Western blot analysis of extracts of various cell lines, using CHD3 Rabbit mAb (NBP3-16632) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.")
![Western Blot: CHD3 Antibody (8Z6L6) [NBP3-16632] - Western blot analysis of extracts of Rat brain, using CHD3 Rabbit mAb (NBP3-16632) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.](http://images.novusbio.com/fullsize/CHD3-Antibody-8Z6L6-Western-Blot-NBP3-16632-img0007.jpg "Western Blot: CHD3 Antibody (8Z6L6) [NBP3-16632] - Western blot analysis of extracts of Rat brain, using CHD3 Rabbit mAb (NBP3-16632) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.")
![Immunocytochemistry/ Immunofluorescence: CHD3 Antibody (8Z6L6) [NBP3-16632] - Confocal imaging of paraffin-embedded Human kidney using CHD3 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.](http://images.novusbio.com/fullsize/nbp3-16632_rabbit-chd3-mab-8z6l6-52202511411435.jpg "Immunocytochemistry/ Immunofluorescence: CHD3 Antibody (8Z6L6) [NBP3-16632] - Confocal imaging of paraffin-embedded Human kidney using CHD3 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.")
![Immunocytochemistry/ Immunofluorescence: CHD3 Antibody (8Z6L6) [NBP3-16632] - Confocal imaging of paraffin-embedded Mouse brain using CHD3 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.](http://images.novusbio.com/fullsize/nbp3-16632_rabbit-chd3-mab-8z6l6-5220251265342.jpg "Immunocytochemistry/ Immunofluorescence: CHD3 Antibody (8Z6L6) [NBP3-16632] - Confocal imaging of paraffin-embedded Mouse brain using CHD3 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.")
![Immunohistochemistry: CHD3 Antibody (8Z6L6) [NBP3-16632] - Immunohistochemistry analysis of CHD3 in paraffin-embedded rat spleen tissue using CHD3 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16632_rabbit-chd3-mab-8z6l6-522025125490.jpg "Immunohistochemistry: CHD3 Antibody (8Z6L6) [NBP3-16632] - Immunohistochemistry analysis of CHD3 in paraffin-embedded rat spleen tissue using CHD3 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: CHD3 Antibody (8Z6L6) [NBP3-16632] - Immunohistochemistry analysis of CHD3 in paraffin-embedded human tonsil tissue using CHD3 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16632_rabbit-chd3-mab-8z6l6-5220251265339.jpg "Immunohistochemistry: CHD3 Antibody (8Z6L6) [NBP3-16632] - Immunohistochemistry analysis of CHD3 in paraffin-embedded human tonsil tissue using CHD3 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: CHD3 Antibody (8Z6L6) [NBP3-16632] - Immunohistochemistry analysis of CHD3 in paraffin-embedded human cervix cancer tissue using CHD3 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16632_rabbit-chd3-mab-8z6l6-522025125557.jpg "Immunohistochemistry: CHD3 Antibody (8Z6L6) [NBP3-16632] - Immunohistochemistry analysis of CHD3 in paraffin-embedded human cervix cancer tissue using CHD3 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: CHD3 Antibody (8Z6L6) [NBP3-16632] - Immunohistochemistry analysis of CHD3 in paraffin-embedded mouse brain tissue using CHD3 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16632_rabbit-chd3-mab-8z6l6-52202511361221.jpg "Immunohistochemistry: CHD3 Antibody (8Z6L6) [NBP3-16632] - Immunohistochemistry analysis of CHD3 in paraffin-embedded mouse brain tissue using CHD3 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: CHD3 Antibody (8Z6L6) [NBP3-16632] - Immunohistochemistry analysis of CHD3 in paraffin-embedded mouse kidney tissue using CHD3 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16632_rabbit-chd3-mab-8z6l6-52202511411470.jpg "Immunohistochemistry: CHD3 Antibody (8Z6L6) [NBP3-16632] - Immunohistochemistry analysis of CHD3 in paraffin-embedded mouse kidney tissue using CHD3 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: CHD3 Antibody (8Z6L6) [CHD3] - Immunohistochemistry analysis of CHD3 in paraffin-embedded mouse kidney tissue using CHD3 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16632_rabbit-chd3-mab-8z6l6-52202517284947.jpg "Immunohistochemistry: CHD3 Antibody (8Z6L6) [CHD3] - Immunohistochemistry analysis of CHD3 in paraffin-embedded mouse kidney tissue using CHD3 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: CHD3 Antibody (8Z6L6) [CHD3] - Immunohistochemistry analysis of CHD3 in paraffin-embedded human cervix cancer tissue using CHD3 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16632_rabbit-chd3-mab-8z6l6-52202517192918.jpg "Immunohistochemistry: CHD3 Antibody (8Z6L6) [CHD3] - Immunohistochemistry analysis of CHD3 in paraffin-embedded human cervix cancer tissue using CHD3 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: CHD3 Antibody (8Z6L6) [CHD3] - Immunohistochemistry analysis of CHD3 in paraffin-embedded mouse brain tissue using CHD3 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16632_rabbit-chd3-mab-8z6l6-52202517152738.jpg "Immunohistochemistry: CHD3 Antibody (8Z6L6) [CHD3] - Immunohistochemistry analysis of CHD3 in paraffin-embedded mouse brain tissue using CHD3 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunocytochemistry/ Immunofluorescence: CHD3 Antibody (8Z6L6) [CHD3] - Confocal imaging of paraffin-embedded Human kidney using CHD3 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) .DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.](http://images.novusbio.com/fullsize/nbp3-16632_rabbit-chd3-mab-8z6l6-52202517152760.jpg "Immunocytochemistry/ Immunofluorescence: CHD3 Antibody (8Z6L6) [CHD3] - Confocal imaging of paraffin-embedded Human kidney using CHD3 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) .DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.")
![Immunohistochemistry: CHD3 Antibody (8Z6L6) [CHD3] - Immunohistochemistry analysis of CHD3 in paraffin-embedded rat spleen tissue using CHD3 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16632_rabbit-chd3-mab-8z6l6-52202517184574.jpg "Immunohistochemistry: CHD3 Antibody (8Z6L6) [CHD3] - Immunohistochemistry analysis of CHD3 in paraffin-embedded rat spleen tissue using CHD3 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunocytochemistry/ Immunofluorescence: CHD3 Antibody (8Z6L6) [CHD3] - Confocal imaging of paraffin-embedded Mouse brain using CHD3 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) .DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.](http://images.novusbio.com/fullsize/nbp3-16632_rabbit-chd3-mab-8z6l6-52202517192917.jpg "Immunocytochemistry/ Immunofluorescence: CHD3 Antibody (8Z6L6) [CHD3] - Confocal imaging of paraffin-embedded Mouse brain using CHD3 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) .DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.")
![Immunohistochemistry: CHD3 Antibody (8Z6L6) [CHD3] - Immunohistochemistry analysis of CHD3 in paraffin-embedded human tonsil tissue using CHD3 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16632_rabbit-chd3-mab-8z6l6-52202517184570.jpg "Immunohistochemistry: CHD3 Antibody (8Z6L6) [CHD3] - Immunohistochemistry analysis of CHD3 in paraffin-embedded human tonsil tissue using CHD3 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Agonist Activity CD30/TNFRSF8 Antibody (81337) [Unconjugated]](https://images.novusbio.com/images2/CD30_MAB229_Functional_Assay_20875.jpg)
![Flow Cytometry CD30/TNFRSF8 Antibody (81337) [Unconjugated]](https://images.novusbio.com/images2/CD30_MAB229_Flow_Cytometry_20165.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")