CENPI Antibody Summary
Immunogen |
This antibody has been engineered to specifically recognize the recombinant protein CENPI using the following amino acid sequence: PRNSKNISKHGQNNPVGDYEHADDQAEEDALQMAVGYFEKGPIKASQNKDKTLEKHLKTVENVAWKNGLASEEIDILLNIALSGKFGNAVN |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CENPI |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
- Western Blot 0.04-0.4 µg/ml
|
Application Notes |
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, pH 7.2, 40% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for CENPI Antibody
Background
The product of this gene is involved in the response of gonadal tissues to follicle-stimulating hormone. This gene is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, WB
Species: Ha, Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, PLA, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ICC/IF, WB
Species: Bv, Eq, Hu, Mu
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IP, KD, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: WB, ICC/IF
Publications for CENPI Antibody (NBP3-24732) (0)
There are no publications for CENPI Antibody (NBP3-24732).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CENPI Antibody (NBP3-24732) (0)
There are no reviews for CENPI Antibody (NBP3-24732).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CENPI Antibody (NBP3-24732) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CENPI Products
Blogs on CENPI