Home » CD48/SLAMF2 » CD48/SLAMF2 Proteins » CD48/SLAMF2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

CD48/SLAMF2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CD48/SLAMF2 Recombinant Protein Antigen (NBP2-55445PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CD48/SLAMF2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD48/SLAMF2.

Source: E. coli

Amino Acid Sequence: VQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CD48
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55445.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD48/SLAMF2 Recombinant Protein Antigen

  • BCM1 surface antigen
  • BCM1
  • BCM1Leukocyte antigen MEM-102
  • BLAST
  • BLAST1
  • BLAST1TCT.1
  • B-lymphocyte activation marker BLAST-1
  • CD48 antigen (B-cell membrane protein)
  • CD48 antigen
  • CD48 molecule
  • CD48
  • hCD48
  • mCD48
  • MEM-102
  • SLAMF2

Background

CD48 is a glycosyl phophatidyl inositol (GPI) anchored cell surface protein also known as Blast1, HuLy m3, BCM1 (in mouse), and OX45 (in rat). CD48 is strongly expressed on lymphocytes and monocytes and weakly on granulocytes but is absent on platelets, fibrolasts, epithelium and endothelium. CD48 is one of the markers for detecting the defects of GPI anchoring structure on patients with paroxysmal nocturnal hemoglobulinuria (PNH) and serves as a low affinity ligand for CD2. The CD48 antigen is closely related to the activation antigen, Blast 1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
CD2 Antibody
(RPA-2.10)
NBP2-25200
Flow Cytometry CD2 Antibody (RPA-2.10)
Flow Cytometry CD2 Antibody (RPA-2.10)
Flow Cytometry CD2 Antibody (RPA-2.10)
(1 Review)
Species: Hu
Applications: B/N, Flow, IHC, IHC-Fr, WB
2B4/CD244/SLAMF4
Antibody [Unconjugate ...
AF1039
Western Blot 2B4/CD244/SLAMF4 Antibody [Unconjugated]
Flow Cytometry 2B4/CD244/SLAMF4 Antibody [Unconjugated]
Immunohistochemistry 2B4/CD244/SLAMF4 Antibody [Unconjugated]
(3 Publications)
Species: Hu
Applications: AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, WB
CD58/LFA-3
Antibody (TS2/9) - Az ...
NBP2-22542
Flow Cytometry CD58/LFA-3 Antibody (TS2/9) - Azide and BSA Free
Flow Cytometry CD58/LFA-3 Antibody (TS2/9) - Azide and BSA Free
Flow Cytometry CD58/LFA-3 Antibody (TS2/9) - Azide and BSA Free
(1 Publication)
Species: Hu
Applications: B/N, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IP, WB
SLAM/CD150 Antibody
AF4330
Flow Cytometry SLAM/CD150 Antibody
(1 Review)
Species: Mu
Applications: CyTOF-ready, Flow, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(377 Publications)
Species: Hu
Applications: BA
SH2D1A Antibody
(1C9)
H00004068-M01
Western Blot SH2D1A Antibody (1C9)
Flow Cytometry SH2D1A Antibody (1C9)
ELISA SH2D1A Antibody (1C9)
(1 Review)
(9 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
CD59 Antibody
(MEM-43) - BSA Free
NB500-330
Immunohistochemistry-Frozen CD59 Antibody (MEM-43) - BSA Free
Immunohistochemistry-Paraffin CD59 Antibody (MEM-43) - BSA Free
Flow Cytometry CD59 Antibody (MEM-43) - BSA Free
(1 Review)
(7 Publications)
Species: Hu
Applications: B/N, CyTOF-ready, Flow, IHC, IHC-Fr, IHC-P, IP
Glucose 6
phosphate isomerase A ...
NBP2-02541
Western Blot Glucose 6 phosphate isomerase Antibody (OTI2D2)
Immunohistochemistry-Paraffin Glucose 6 phosphate isomerase Antibody (OTI2D2)
Immunohistochemistry-Paraffin Glucose 6 phosphate isomerase Antibody (OTI2D2)
(1 Publication)
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
GNPDA1 Antibody
NBP2-24653
Western Blot GNPDA1 Antibody
Immunohistochemistry-Paraffin GNPDA1 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
B7-1/CD80 Antibody
(37711) [Unconjugated ...
MAB140
Flow Cytometry B7-1/CD80 Antibody (37711) [Unconjugated]
Immunohistochemistry B7-1/CD80 Antibody (37711) [Unconjugated]
Dual RNAscope ISH-IHC Compatible B7-1/CD80 Antibody (37711) [Unconjugated]
(26 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(50 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
ICAM-1/CD54
Antibody [Unconjugate
AF796
Immunohistochemistry ICAM-1/CD54 Antibody [Unconjugated]
Western Blot ICAM-1/CD54 Antibody [Unconjugated]
Western Blot ICAM-1/CD54 Antibody [Unconjugated]
(6 Reviews)
(88 Publications)
Species: Mu
Applications: AdBlk, IHC, WB
IFN-gamma
[Unconjugated]
285-IF
Bioactivity IFN-gamma [Unconjugated]
SDS-PAGE IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(2 Reviews)
(455 Publications)
Species: Hu
Applications: BA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
CD3 Antibody (SP7)
NB600-1441
Immunohistochemistry-Frozen CD3 Antibody (SP7)
Immunohistochemistry-Paraffin CD3 Antibody (SP7)
Immunohistochemistry-Paraffin CD3 Antibody (SP7)
(3 Reviews)
(45 Publications)
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD
CD84/SLAMF5
Antibody (273508)
MAB1855
CD84/SLAMF5 Antibody (273508)
(2 Publications)
Species: Hu
Applications: WB
CD8 Antibody
(53-6.7) - BSA Free
NBP1-49045
Immunohistochemistry-Paraffin CD8 Antibody (53-6.7) - BSA Free
Immunocytochemistry/ Immunofluorescence CD8 Antibody (53-6.7) - BSA Free
Immunohistochemistry-Frozen CD8 Antibody (53-6.7) - BSA Free
(3 Reviews)
(28 Publications)
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc

Publications for CD48/SLAMF2 Recombinant Protein Antigen (NBP2-55445PEP) (0)

There are no publications for CD48/SLAMF2 Recombinant Protein Antigen (NBP2-55445PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD48/SLAMF2 Recombinant Protein Antigen (NBP2-55445PEP) (0)

There are no reviews for CD48/SLAMF2 Recombinant Protein Antigen (NBP2-55445PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD48/SLAMF2 Recombinant Protein Antigen (NBP2-55445PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD48/SLAMF2 Products

Research Areas for CD48/SLAMF2 Recombinant Protein Antigen (NBP2-55445PEP)

Find related products by research area.

Blogs on CD48/SLAMF2

There are no specific blogs for CD48/SLAMF2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The activity is over 2-fold greater than the top competitor's IFN-gamma .
IFN-gamma [Unconjugated]
285-IF-100

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD48/SLAMF2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CD48