Home » CD35 » CD35 Antibodies » CD35 Antibody
Novus Biologicals products are now on bio-techne.com

CD35 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: CD35 Antibody [NBP2-13870] - Analysis in human tonsil and skeletal muscle tissues using NBP2-13870 antibody. Corresponding CD35 RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: CD35 Antibody [NBP2-13870] - Analysis in human tonsil and skeletal muscle tissues using NBP2-13870 antibody. Corresponding CD35 RNA-seq data are presented for ...read more
Immunohistochemistry-Paraffin: CD35 Antibody [NBP2-13870] - Staining of human skletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: CD35 Antibody [NBP2-13870] - Staining of human tonsil shows cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: CD35 Antibody [NBP2-13870] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: CD35 Antibody [NBP2-13870] - Staining of human kidney shows moderate membranous positivity in cells in glomeruli.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CD35 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: LIGSPSTTCLVSGNNVTWDKKAPICEIISCEPPPTISNGDFYSNNRTSFHNGTVVTYQCHTGPDGEQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CD35 Protein (NBP2-13870PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CD35 Antibody

  • C3BR
  • CD35
  • complement component (3b/4b) receptor 1 (Knops blood group)
  • CR1
  • KN

Background

CD35 encodes a membrane glycoprotein found on peripheral blood cells, glomerular podocytes, and follicular dendritic cells. The protein is a receptor for complement components C3b and C4b and regulates the activity of the complement cascade. Variation in this protein is the basis of the Knops blood group system. The two most common alleles, F and S, differ by 8 exons and are thought to be the result of an unequal crossover event. A secreted form of the protein present in plasma has been described, but its full length nature has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CD21 Antibody
(SC0681)
NBP2-67605
Immunocytochemistry/ Immunofluorescence CD21 Antibody (SC0681)
Immunocytochemistry/ Immunofluorescence CD21 Antibody (SC0681)
Immunohistochemistry-Paraffin CD21 Antibody (SC0681)
(1 Publication)
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC, IHC-P, IP, ISH, WB
Complement C3
Antibody (11H9) - BSA ...
NB200-540
Flow Cytometry Complement C3 Antibody (11H9) - BSA Free
Immunocytochemistry/ Immunofluorescence Complement C3 Antibody (11H9) - BSA Free
Immunohistochemistry-Paraffin Complement C3 Antibody (11H9) - BSA Free
(2 Reviews)
(31 Publications)
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
CD55/DAF Antibody
[Unconjugated]
AF2009
Immunohistochemistry CD55/DAF Antibody [Unconjugated]
Immunocytochemistry CD55/DAF Antibody [Unconjugated]
(8 Publications)
Species: Hu
Applications: ICC, IHC
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
CD11b Antibody -
BSA Free
NB110-89474
Immunocytochemistry/ Immunofluorescence CD11b Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CD11b Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CD11b Antibody - BSA Free
(12 Reviews)
(114 Publications)
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
CD46 Antibody
(344519) [Unconjugate
MAB2005
N/A CD46 Antibody (344519) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, WB
Integrin beta
2/CD18 Antibody [Unco ...
AF1730
Immunocytochemistry Integrin beta 2/CD18 Antibody [Unconjugated]
Immunocytochemistry Integrin beta 2/CD18 Antibody [Unconjugated]
(16 Publications)
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
CD59 Antibody
(MEM-43) - BSA Free
NB500-330
Immunohistochemistry-Frozen CD59 Antibody (MEM-43) - BSA Free
Immunohistochemistry-Paraffin CD59 Antibody (MEM-43) - BSA Free
Flow Cytometry CD59 Antibody (MEM-43) - BSA Free
(1 Review)
(6 Publications)
Species: Hu
Applications: B/N, CyTOF-ready, Flow, IHC, IHC-Fr, IHC-P, IP
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(809 Publications)
Species: Hu
Applications: BA
Lymphotoxin beta
R/TNFRSF3 Antibody
AF629
Lymphotoxin beta R/TNFRSF3 Antibody
(10 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, InhibCellGro, WB
Complement Factor
H Antibody [Unconjuga ...
AF4779
Immunohistochemistry Complement Factor H Antibody [Unconjugated]
(1 Review)
(2 Publications)
Species: Hu
Applications: IHC, WB
Complement C4b/d
Antibody (16D2)
NB200-541
Western Blot Complement C4b/d Antibody (16D2)
(12 Publications)
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
Fc gamma RIII
(CD16) Antibody [Unco ...
AF1597
Western Blot Fc gamma RIII (CD16) Antibody [Unconjugated]
(8 Publications)
Species: Hu
Applications: Block, WB
Fc gamma
RIIIA/CD16a [Unconjug
4325-FC
SDS-PAGE Fc gamma RIIIA/CD16a [Unconjugated]
Binding Activity Fc gamma RIIIA/CD16a [Unconjugated]
SEC-MALS Fc gamma RIIIA/CD16a [Unconjugated]
(20 Publications)
Species: Hu
Applications: Bind
Complement C4
Antibody
NBP3-12295
Immunohistochemistry-Paraffin Complement C4 Antibody
Immunohistochemistry-Paraffin Complement C4 Antibody
Immunohistochemistry-Paraffin Complement C4 Antibody
Species: Hu, Pm, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
CapG Antibody
NBP1-90214
Immunocytochemistry/ Immunofluorescence CapG Antibody
Western Blot CapG Antibody
Immunohistochemistry-Paraffin CapG Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CX3CL1/Fractalkine
Antibody [Unconjugate ...
AF365
Neutralization CX3CL1/Fractalkine Antibody [Unconjugated]
(2 Reviews)
(33 Publications)
Species: Hu
Applications: Neut, WB
CD35 Antibody
NBP2-13870
CD35 Antibody
Species: Hu
Applications: IHC

Publications for CD35 Antibody (NBP2-13870) (0)

There are no publications for CD35 Antibody (NBP2-13870).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD35 Antibody (NBP2-13870) (0)

There are no reviews for CD35 Antibody (NBP2-13870). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CD35 Antibody (NBP2-13870) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD35 Products

Research Areas for CD35 Antibody (NBP2-13870)

Find related products by research area.

Blogs on CD35.

Check out the latest blog posts on CD35.
How To Identify B Cell Subsets Using Flow Cytometry
By Victoria OsinskiUsing Flow Cytometry to Identify B Cell SubsetsIdentifying cellular subsets by flow cytometry requires careful and thorough planning in order to ensure the correct subset of cells are identified...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD35 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol CR1