Home » CD30/TNFRSF8 » CD30/TNFRSF8 Proteins » CD30/TNFRSF8 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

CD30/TNFRSF8 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CD30/TNFRSF8 Protein (NBP2-38201PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

CD30/TNFRSF8 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TNFRSF8.

Source: E. coli

Amino Acid Sequence: DTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TNFRSF8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38201.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD30/TNFRSF8 Recombinant Protein Antigen

  • CD30 antigen
  • CD30
  • CD30KI-1
  • CD30L receptor
  • cytokine receptor CD30
  • D1S166EKi-1
  • Ki-1 antigen
  • Lymphocyte activation antigen CD30
  • TNFRSF8
  • tumor necrosis factor receptor superfamily member 8
  • tumor necrosis factor receptor superfamily, member 8

Background

CD30 is a type I transmembrane protein and a member of the tumor necrosis factor receptor superfamily of proteins. (1,2) Murine CD30 is expressed predominantly in the thymus, and it is inducible in mouse splenocytes stimulated with pokeweed mitogen or concanavalin A. (1) In anti-CD3epsilon-activated spleen cells, CD30 is expressed primarily on the surface of CD8+ T cells with peak expression on days 4 and 5. Stimulation of CD30+ CTL lines with plate-bound anti-CD30 directly signals IL-5 but not IFN; production. (1) While these studies demonstrate that CD30 directs cytokine secretion and suggest that CD30 may play a pivotal role in the pattern of cytokine production by T cells, the precise roles of CD30 and its ligand (CD153) in T-cell development have not been clearly defined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
CD3 Antibody
(17A2) [Unconjugated]
MAB4841
Immunohistochemistry CD3 Antibody (17A2) [Unconjugated]
Immunocytochemistry CD3 Antibody (17A2) [Unconjugated]
Immunohistochemistry CD3 Antibody (17A2) [Unconjugated]
(42 Publications)
Species: Mu
Applications: CompCytotox, CyTOF-ready, Flow, ICC, IHC, IP, Tstim
Cytokeratin 20
Antibody (SA35-03)
NBP2-67309
Flow Cytometry Cytokeratin 20 Antibody (SA35-03)
Immunocytochemistry/ Immunofluorescence Cytokeratin 20 Antibody (SA35-03)
Immunohistochemistry-Paraffin Cytokeratin 20 Antibody (SA35-03)
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(803 Publications)
Species: Hu
Applications: BA
CD20 Antibody
(AISB12) - BSA Free
NBP1-43435
Western Blot CD20 Antibody (AISB12) - BSA Free
Flow Cytometry CD20 Antibody (AISB12) - BSA Free
(3 Publications)
Species: Hu, Mu
Applications: Flow, WB
CD45 Antibody
[Unconjugated]
AF114
Immunohistochemistry CD45 Antibody [Unconjugated]
Immunocytochemistry CD45 Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence CD45 Antibody [Unconjugated]
(1 Review)
(63 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(49 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(369 Publications)
Species: Hu
Applications: BA
CD30 Ligand/TNFSF8
Antibody [Unconjugate ...
AF1028
Immunohistochemistry CD30 Ligand/TNFSF8 Antibody [Unconjugated]
Immunohistochemistry CD30 Ligand/TNFSF8 Antibody [Unconjugated]
Flow Cytometry CD30 Ligand/TNFSF8 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
CD8 Antibody
(53-6.7) - BSA Free
NBP1-49045
Immunohistochemistry-Paraffin CD8 Antibody (53-6.7) - BSA Free
Immunocytochemistry/ Immunofluorescence CD8 Antibody (53-6.7) - BSA Free
Immunohistochemistry-Frozen CD8 Antibody (53-6.7) - BSA Free
(3 Reviews)
(26 Publications)
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
CD25/IL-2R alpha
[HRP]
DR2A00
N/A CD25/IL-2R alpha [HRP]
N/A CD25/IL-2R alpha [HRP]
(36 Publications)
Species: Hu
Applications: ELISA
MUC1 Antibody -
BSA Free
NBP1-60046
Knockout Validated MUC1 Antibody - BSA Free
Knockout Validated MUC1 Antibody - BSA Free
Chromatin Immunoprecipitation MUC1 Antibody - BSA Free
(8 Publications)
Species: Bv, Eq, Gt, Gp, Hu, Mu, Po, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KO, WB
ISG20 Antibody
(1B2-3C9)
H00003669-M01
Western Blot ISG20 Antibody (1B2-3C9)
Western Blot ISG20 Antibody (1B2-3C9)
Immunocytochemistry/ Immunofluorescence ISG20 Antibody (1B2-3C9)
(1 Review)
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
ALK/CD246 Antibody
[Unconjugated]
AF4210
Western Blot ALK/CD246 Antibody [Unconjugated]
Immunohistochemistry ALK/CD246 Antibody [Unconjugated]
Simple Western ALK/CD246 Antibody [Unconjugated]
(1 Review)
Species: Hu
Applications: IHC, Simple Western, WB
IFN-gamma
[Unconjugated]
285-IF
Bioactivity IFN-gamma [Unconjugated]
SDS-PAGE IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(2 Reviews)
(445 Publications)
Species: Hu
Applications: BA

Publications for CD30/TNFRSF8 Protein (NBP2-38201PEP) (0)

There are no publications for CD30/TNFRSF8 Protein (NBP2-38201PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD30/TNFRSF8 Protein (NBP2-38201PEP) (0)

There are no reviews for CD30/TNFRSF8 Protein (NBP2-38201PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD30/TNFRSF8 Protein (NBP2-38201PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD30/TNFRSF8 Products

Research Areas for CD30/TNFRSF8 Protein (NBP2-38201PEP)

Find related products by research area.

Blogs on CD30/TNFRSF8.

Check out the latest blog posts on CD30/TNFRSF8.
Unlocking the Potential of Biosimilars in Immuno-Oncology
By Jennifer Jones, M.S.Biosimilar Antibodies: Imitation Meets InnovationIn the ever-evolving medical landscape, a new class of pharmaceuticals is emerging as a game-changer, poised to transform the way we approach...  Read full blog post.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD30/TNFRSF8 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol TNFRSF8