![Western Blot: CBX3 Antibody [NBP2-92962] - Western blot analysis of extracts from normal (control) and HP1 gamma/CBX3 knockout (KO) 293T cells, using HP1 gamma/CBX3 antibody (NBP2-92962) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.](http://images.novusbio.com/fullsize/CBX3-Antibody-Western-Blot-NBP2-92962-img0011.jpg "Western Blot: CBX3 Antibody [NBP2-92962] - Western blot analysis of extracts from normal (control) and HP1 gamma/CBX3 knockout (KO) 293T cells, using HP1 gamma/CBX3 antibody (NBP2-92962) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IP, KO |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-183 of human CBX3 (NP_009207.2). MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CBX3 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 20 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CBX3 Antibody (NBP2-92962)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CBX3 |
![Western Blot: CBX3 Antibody [NBP2-92962] - Analysis of extracts of various cell lines, using CBX3 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 5s.](http://images.novusbio.com/fullsize/CBX3-Antibody-Western-Blot-NBP2-92962-img0005.jpg "Western Blot: CBX3 Antibody [NBP2-92962] - Analysis of extracts of various cell lines, using CBX3 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 5s.")
![Immunoprecipitation: CBX3 Antibody [NBP2-92962] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug CBX3 antibody (NBP2-92962). Western blot was performed from the immunoprecipitate using CBX3 antibody (NBP2-92962) at a dilution of 1:1000.](http://images.novusbio.com/fullsize/CBX3-Antibody-Immunoprecipitation-NBP2-92962-img0006.jpg "Immunoprecipitation: CBX3 Antibody [NBP2-92962] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug CBX3 antibody (NBP2-92962). Western blot was performed from the immunoprecipitate using CBX3 antibody (NBP2-92962) at a dilution of 1:1000.")
![Immunocytochemistry/Immunofluorescence: CBX3 Antibody [NBP2-92962] - Immunofluorescence analysis of C6 cells using HP1 gamma/CBX3 antibody (NBP2-92962) at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/CBX3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-92962-img0007.jpg "Immunocytochemistry/Immunofluorescence: CBX3 Antibody [NBP2-92962] - Immunofluorescence analysis of C6 cells using HP1 gamma/CBX3 antibody (NBP2-92962) at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: CBX3 Antibody [NBP2-92962] - Analysis of U-2 OS cells using CBX3 at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/CBX3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-92962-img0001.jpg "Immunocytochemistry/Immunofluorescence: CBX3 Antibody [NBP2-92962] - Analysis of U-2 OS cells using CBX3 at dilution of 1:100. Blue: DAPI for nuclear staining.")
![N/A alpha-Defensin 1 [Biotin]](https://images.novusbio.com/images2/DATA_alphaDefensin_1_DY819805_ELISA_2534.jpg)
![Western Blot Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/Histone_H2AX_AF2288_Western_Blot_5182.jpg)
![Simple Western Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/16395.jpg)
![Immunocytochemistry Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/Histone_H2AX_AF2288_Immunocytochemistry__Immunofluorescence_16920.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")