![Immunohistochemistry-Paraffin: Capicua Antibody [NBP2-33420] - Staining in human testis and liver tissues . Corresponding CIC RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Capicua-Antibody-Immunohistochemistry-Paraffin-NBP2-33420-img0011.jpg "Immunohistochemistry-Paraffin: Capicua Antibody [NBP2-33420] - Staining in human testis and liver tissues . Corresponding CIC RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PKRKMRRRSSCSSEPNTPKSAKCEGDIFTFDRTGTEAEDVLGELEYDKVPYSSLRRTLDQRRALVMQLFQDHGFFPSAQATAAFQARYADIFPSKVCLQLKIREVRQKIMQA |
| Predicted Species | Mouse (98%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CIC |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Capicua Antibody (NBP2-33420)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: Capicua Antibody [NBP2-33420] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-CIC antibody. Remaining relative intensity is presented. Loading control: anti-GAPDH.](http://images.novusbio.com/fullsize/Capicua-Antibody-Western-Blot-NBP2-33420-img0013.jpg "Western Blot: Capicua Antibody [NBP2-33420] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-CIC antibody. Remaining relative intensity is presented. Loading control: anti-GAPDH.")
![Western Blot: Capicua Antibody [NBP2-33420] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented](http://images.novusbio.com/fullsize/Capicua-Antibody-Western-Blot-NBP2-33420-img0014.jpg "Western Blot: Capicua Antibody [NBP2-33420] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented")
![Immunocytochemistry/Immunofluorescence: Capicua Antibody [NBP2-33420] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Staining is shown in green.](http://images.novusbio.com/fullsize/Capicua-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33420-img0012.jpg "Immunocytochemistry/Immunofluorescence: Capicua Antibody [NBP2-33420] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Staining is shown in green.")
![Western Blot: Capicua Antibody [NBP2-33420] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line A-549](http://images.novusbio.com/fullsize/Capicua-Antibody-Western-Blot-NBP2-33420-img0005.jpg "Western Blot: Capicua Antibody [NBP2-33420] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line A-549")
![Immunohistochemistry-Paraffin: Capicua Antibody [NBP2-33420] - Staining of human cerebellum shows strong nuclear immunoreactivity in Purkinje cells, as well as positivity in neurons in granular and molecular layers.](http://images.novusbio.com/fullsize/Capicua-Antibody-Immunohistochemistry-Paraffin-NBP2-33420-img0007.jpg "Immunohistochemistry-Paraffin: Capicua Antibody [NBP2-33420] - Staining of human cerebellum shows strong nuclear immunoreactivity in Purkinje cells, as well as positivity in neurons in granular and molecular layers.")
![Immunohistochemistry-Paraffin: Capicua Antibody [NBP2-33420] - Staining of human endometrium shows moderate to strong nuclear positivity in glandular stromal cells.](http://images.novusbio.com/fullsize/Capicua-Antibody-Immunohistochemistry-Paraffin-NBP2-33420-img0008.jpg "Immunohistochemistry-Paraffin: Capicua Antibody [NBP2-33420] - Staining of human endometrium shows moderate to strong nuclear positivity in glandular stromal cells.")
![Immunohistochemistry-Paraffin: Capicua Antibody [NBP2-33420] - Staining of human liver shows very weak nuclear positivity in hepatocytes.](http://images.novusbio.com/fullsize/Capicua-Antibody-Immunohistochemistry-Paraffin-NBP2-33420-img0009.jpg "Immunohistochemistry-Paraffin: Capicua Antibody [NBP2-33420] - Staining of human liver shows very weak nuclear positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: Capicua Antibody [NBP2-33420] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/Capicua-Antibody-Immunohistochemistry-Paraffin-NBP2-33420-img0010.jpg "Immunohistochemistry-Paraffin: Capicua Antibody [NBP2-33420] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.")
![N/A C-Reactive Protein/CRP [Biotin]](https://images.novusbio.com/images2/DATA_CReactive_Protein_DY1707_ELISA_1701.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")