We recently ordered the anti c-myb antibody and I note that on the blot the MW of the band is 36kDa though c-myb should have a MW of 75 kDa. How was the specificity verified? Is the immunizing antigen available for performing a preabsorption negative control?

Name: c-Myb Antibody
Brand: Novus Biologicals
SKU: NBP1-80306
Rating: 5 (1 reviews)

Question

We recently ordered the anti c-myb antibody and I note that on the blot the MW of the band is 36kDa though c-myb should have a MW of 75 kDa.  How was the specificity verified?  Is the immunizing antigen available for performing a preabsorption negative control?

Accepted Answer

c-Myb has at least 12 known isoforms and one of these isoforms is around 37 kDa. There is a blocking peptide available for NBP1-80306. The catalog number will be NBP1-80306PEP

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	Hu, AvSpecies Glossary
Applications	WB, ICC/IF, IHC, KD
Clonality	Polyclonal
Host	Rabbit
Conjugate	Unconjugated
Concentration	0.5 mg/ml

Description	The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen	Synthetic peptide directed towards the N terminal of human MYB. Peptide sequence YDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTD. The peptide sequence for this immunogen was taken from within the described region.
Isotype	IgG
Clonality	Polyclonal
Host	Rabbit
Gene	MYB
Purity	Affinity purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer	PBS, 2% Sucrose
Preservative	0.09% Sodium Azide
Concentration	0.5 mg/ml
Purity	Affinity purified

Publications using NBP1-80306	Applications	Species
Wakamatsu Y, Suzuki K Sequence alteration in the enhancer contributes to the heterochronic Sox9 expression in marsupial cranial neural crest Dev. Biol. 2019-08-17 [PMID: 31430446] (ICC/IF, Avian)	ICC/IF	Avian
Zhu Z R, He Q et al. MiR-140-3p is Involved in In-Stent Restenosis by Targeting C-Myb and BCL-2 in Peripheral Artery Disease. J Atheroscler Thromb 2018-01-11 [PMID: 29760303] (WB, IF/IHC, Human)	WB, IF/IHC	Human

c-Myb Antibody

Species Glossary

Images

Product Details

Order Details

c-Myb Antibody Summary

Applications/Dilutions

Reactivity Notes

Packaging, Storage & Formulations

Alternate Names for c-Myb Antibody

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for c-Myb Antibody (NBP1-80306)(2)

Review for c-Myb Antibody (NBP1-80306) (1) 51

Summary

Product General Protocols

Video Protocols

FAQs for c-Myb Antibody (NBP1-80306). (Showing 1 - 1 of 1 FAQs).

Secondary Antibodies

Isotype Controls

Additional c-Myb Products

Research Areas for c-Myb Antibody (NBP1-80306)

Blogs on c-Myb

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Recent Reviews

Bioinformatics

	Verified Customer 07/17/2014
Application:	WB
Species:	Human

Gene Symbol	MYB
Uniprot	EAW47967(Human)