![Western Blot: BRN4 Antibody [NBP2-68787] - Analysis in human cerebral cortex tissue.](http://images.novusbio.com/fullsize/BRN4-Antibody-Western-Blot-NBP2-68787-img0002.jpg "Western Blot: BRN4 Antibody [NBP2-68787] - Analysis in human cerebral cortex tissue.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SNGHPLGHHWVTSLSDGGPWSSTLATSPLDQQDVKPGREDLQLGAIIHHR |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | POU3F4 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF Fixation/Permeabilization: PFA/Triton X-100 |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | POU3F4 |
![Immunocytochemistry/Immunofluorescence: BRN4 Antibody [NBP2-68787] - Staining of human cell line AF22 shows localization to nucleus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/BRN4-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-68787-img0001.jpg "Immunocytochemistry/Immunofluorescence: BRN4 Antibody [NBP2-68787] - Staining of human cell line AF22 shows localization to nucleus. Antibody staining is shown in green.")
![Immunocytochemistry Glucagon Antibody (181402) [Unconjugated]](https://images.novusbio.com/images2/Glucagon_MAB1249_Immunocytochemistry_6560.jpg)
![Intracellular Staining by Flow Cytometry Glucagon Antibody (181402) [Unconjugated]](https://images.novusbio.com/images2/Glucagon_MAB1249_Flow_Cytometry_20264.jpg)
![Western Blot PDX-1/IPF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/PDX-1_AF2419_Western_Blot_5187.jpg)
![Immunocytochemistry PDX-1/IPF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/PDX1_AF2419_Immunocytochemistry_16575.jpg)
![Simple Western PDX-1/IPF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/PDX1_AF2419_Simple_Western_16996.jpg)
![Western Blot Neurogenin-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neurogenin-3_AF3444_Western_Blot_5300.jpg)
![Immunohistochemistry Neurogenin-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/af3444_human-neurogenin-3-affinity-purified-polyclonal-ab-immunohistochemistry-192021141921.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Simple Western Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Simple_Western_17126.jpg)
![Immunocytochemistry Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Immunocytochemistry_14427.jpg)
![Western Blot Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Western_Blot_14743.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")