Novus Biologicals products are now on bio-techne.com

BIN1 Recombinant Protein Antigen

Name: BIN1 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-89103PEP
Price: 279 USD

Images

There are currently no images for BIN1 Protein (NBP1-89103PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

BIN1 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BIN1. Source: E. coli Amino Acid Sequence: VTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHH Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	BIN1
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89103. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.
Theoretical MW	35 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BIN1 Recombinant Protein Antigen

AMPH2
Amphiphysin II
Amphiphysin-like protein
AMPHLDKFZp547F068
box dependant MYC interacting protein 1
bridging integrator 1Box-dependent myc-interacting protein 1
MGC10367
myc box-dependent-interacting protein 1
SH3P9

Background

BIN1 encodes several isoforms of a nucleocytoplasmic adaptor protein, one of which was initially identified as a MYC-interacting protein with features of a tumor suppressor. Isoforms that are expressed in the central nervous system may be involved in synaptic vesicle endocytosis and may interact with dynanim, synaptojanin, endophilin, and clathrin. Isoforms that are expressed in muscle and ubiquitously expressed isoforms localize to the cytoplasm and nucleus and activate a caspase independent apoptotic process. Studies in mouse suggest that this gene plays an important role in cardiac muscle development. Alternate splicing of the gene results in ten transcript variants encoding different isoforms. Aberrant splice variants expressed in tumor cell lines have also been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

c-Myc Antibody
(9E10) - BSA Free

NB600-302

Western Blot c-Myc Antibody (9E10) - BSA Free

(4 Reviews)

(46 Publications)

Species: Bv, Dr, Hu, Mu

Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB

Clusterin/APOJ
Antibody [Unconjugate

AF2747

Western Blot Clusterin/APOJ Antibody [Unconjugated]

(13 Publications)

Species: Mu

Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB

Dynamin 2 Antibody

NBP2-47477

Immunohistochemistry-Paraffin Dynamin 2 Antibody

(3 Publications)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, KO, WB

Amphiphysin/AMPH
Antibody

NBP1-87561

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

PICALM Antibody

NBP1-86658

Immunohistochemistry-Paraffin PICALM Antibody

(7 Publications)

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

CD35 Antibody (E11)

NBP2-29460

(6 Publications)

Species: Pm, Pm-Cm, Hu, Pm, RM

Applications: Flow, ICC/IF, IHC, IHC-P, ISH

Apolipoprotein
E/ApoE Antibody (WUE- ...

NB110-60531

Western Blot Apolipoprotein E/ApoE Antibody (WUE-4) - BSA Free

Flow Cytometry Apolipoprotein E/ApoE Antibody (WUE-4) - BSA Free

(2 Reviews)

(38 Publications)

Species: Hu, Mu, Rt(-)

Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB

Myotubularin
Antibody

NB300-949

(1 Publication)

Species: Hu, Mu

Applications: IHC, IHC-P, PEP-ELISA, WB

Src [p Tyr419]
Antibody [Unconjugate

AF2685

Simple Western Src [p Tyr419] Antibody [Unconjugated]

Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]

(1 Review)

(10 Publications)

Species: Hu

Applications: IHC, Simple Western, WB

BFAR Antibody

NB100-56094

Immunohistochemistry-Paraffin BFAR Antibody

(1 Publication)

Species: Hu

Applications: IHC, IHC-P, IP, WB

beta-2 Adrenergic
R/ADRB2 Antibody (JM1 ...

NBP2-67187

Western Blot beta-2 Adrenergic R/ADRB2 Antibody (JM102-06)

Species: Hu, Mu, Rt, Ze

Applications: ICC/IF, IHC, IHC-P, IP, WB

FXR/NR1H4 Antibody
(A9033A) [Unconjugate ...

PP-A9033A-00

(2 Reviews)

(13 Publications)

Species: Hu

Applications: DirELISA, IHC, IP, WB

p53 Antibody (PAb
240) - BSA Free

NB200-103

Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free

(3 Reviews)

(42 Publications)

Species: Hu, Mu, Rt, Xp(-), Ye

Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

EphA1 Antibody
[Unconjugated]

AF638

Immunocytochemistry EphA1 Antibody [Unconjugated]

(4 Publications)

Species: Hu

Applications: CyTOF-ready, Flow, ICC, WB

Siglec-3/CD33
Antibody (44M12D3) - ...

NBP2-22377

Immunohistochemistry-Paraffin Siglec-3/CD33 Antibody (44M12D3) - BSA Free

(3 Publications)

Species: Hu

Applications: IHC, IHC-P, WB

EXOC3L2 Antibody

NBP3-10693

Species: Hu

Applications: WB

CD2AP Antibody

NBP1-90625

Immunohistochemistry-Paraffin CD2AP Antibody

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

ABCA7 Antibody
(7A1-144)

NB400-163

Species: Mu

Applications: Flow, IHC, IHC-P, WB

Ryanodine Receptor
Antibody (34C) - BSA ...

NB300-543

(12 Publications)

Species: Am, Bv, Ca, Ma, Fi, Hu, Ma-Mn, Mu, Pm, Rb, Rt, Sh

Applications: B/N, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

BIN1 Recombinant
Protein Antigen

NBP1-89103PEP

Species: Hu

Applications: AC

Publications for BIN1 Protein (NBP1-89103PEP) (0)

There are no publications for BIN1 Protein (NBP1-89103PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BIN1 Protein (NBP1-89103PEP) (0)

There are no reviews for BIN1 Protein (NBP1-89103PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BIN1 Protein (NBP1-89103PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BIN1 Products

Research Areas for BIN1 Protein (NBP1-89103PEP)

Find related products by research area.

Blogs on BIN1

There are no specific blogs for BIN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on U-937 cells with c-Myc Antibody (9E10) NB600-302AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.

c-Myc Antibody (9E10) - BSA Free
NB600-302

Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.

p53 Antibody (PAb 240) - BSA Free
NB200-103

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our BIN1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

BIN1

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

BIN1 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

BIN1 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for BIN1 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for BIN1 Protein (NBP1-89103PEP) (0)

Reviews for BIN1 Protein (NBP1-89103PEP) (0)

FAQs for BIN1 Protein (NBP1-89103PEP) (0)

Additional BIN1 Products

Research Areas for BIN1 Protein (NBP1-89103PEP)

Blogs on BIN1

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics