![Western Blot: beta-Catenin Antibody (9L6X0) [NBP3-15842] - Western blot analysis of extracts of Mouse brain, using beta-Catenin antibody (NBP3-15842) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.](http://images.novusbio.com/fullsize/beta-Catenin-Antibody-9L6X0-Western-Blot-NBP3-15842-img0008.jpg "Western Blot: beta-Catenin Antibody (9L6X0) [NBP3-15842] - Western blot analysis of extracts of Mouse brain, using beta-Catenin antibody (NBP3-15842) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IP, KO |
| Clone | 6A3P2 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human beta Catenin (P35222). MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFP |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | CTNNB1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 92 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.05% Proclin 300 |
| Purity | Affinity purified |
![Western Blot beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Western_Blot_5100.jpg)
![Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Chromatin_Immunoprecipitation_11251.jpg)
![Simple Western beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/betaCatenin_AF1329_Simple_Western_17134.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for beta-Catenin Antibody (NBP3-15842)Find related products by research area.
|
|
Read full blog post. |
|
Stemness is responsible for onset and metastasis of colorectal cancer By Jamshed Arslan, Pharm. D., PhD. Colorectal cancer stem cells are a rare subpopulation of colorectal cancer cells that can self-renew and initiate and sustain tumor growth when transplanted into an animal host.1,2 C... Read full blog post. |
|
The role of Wnts in neuroinflammation By Michalina Hanzel, PhDThe multifaceted roles of the Wnt family of glycoproteins have been extensively characterized throughout embryonic development and adult homeostasis. The highly conserved, cell- and tissue- s... Read full blog post. |
|
Stemness for Surviving Hypoxia: TGF-beta/Smad Signaling in Multiple Myeloma By Jamshed Arslan Pharm.D. Multiple myeloma (MM) is a cancer of antibody-producing plasma cells. The bone marrow (BM) of MM patients is hypoxic, and MM cells overexpress many cancerous genes that are regulated by hy... Read full blog post. |
|
Epithelial-Mesenchymal Transition (EMT) Markers Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a... Read full blog post. |
|
CD63: is it pro-metastatic or anti-metastatic? CD63 is a type II membrane protein belonging to tetraspanin superfamily and it play key roles in the activation of several cellular signaling cascades along with acting as TIMP1 receptor. It is expressed by activated platelets, monocytes,... Read full blog post. |
|
Notch1 - A multifunctional transmembrane receptor Notch1 is a member of the Notch family of Type 1 single-pass transmembrane proteins that share an extracellular domain of multiple epidermal growth factor-like (EGF) repeats. Notch family members play key roles in a variety of developmental process... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CTNNB1 |
![Immunocytochemistry/Immunofluorescence: beta-Catenin Antibody (9L6X0) [NBP3-15842] - Immunofluorescence analysis of C6 cells using beta-Catenin antibody (NBP3-15842) at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/beta-Catenin-Antibody-9L6X0-Immunocytochemistry-Immunofluorescence-NBP3-15842-img0006.jpg "Immunocytochemistry/Immunofluorescence: beta-Catenin Antibody (9L6X0) [NBP3-15842] - Immunofluorescence analysis of C6 cells using beta-Catenin antibody (NBP3-15842) at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: beta-Catenin Antibody (9L6X0) [NBP3-15842] - Immunohistochemistry of paraffin-embedded Human pancreatic ductal carcinoma using [KO Validated] beta-Catenin Rabbit mAb (NBP3-15842) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/beta-Catenin-Antibody-9L6X0-Immunohistochemistry-Paraffin-NBP3-15842-img0005.jpg "Immunohistochemistry-Paraffin: beta-Catenin Antibody (9L6X0) [NBP3-15842] - Immunohistochemistry of paraffin-embedded Human pancreatic ductal carcinoma using [KO Validated] beta-Catenin Rabbit mAb (NBP3-15842) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Western Blot: beta-Catenin Antibody (9L6X0) [NBP3-15842] - Western blot analysis of extracts of HeLa cells, using beta-Catenin antibody (NBP3-15842) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.](http://images.novusbio.com/fullsize/beta-Catenin-Antibody-9L6X0-Western-Blot-NBP3-15842-img0007.jpg "Western Blot: beta-Catenin Antibody (9L6X0) [NBP3-15842] - Western blot analysis of extracts of HeLa cells, using beta-Catenin antibody (NBP3-15842) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.")
![Immunohistochemistry-Paraffin: beta-Catenin Antibody (9L6X0) [NBP3-15842] - Immunohistochemistry of paraffin-embedded Human cervical squamous cell carcinoma using [KO Validated] beta-Catenin Rabbit mAb (NBP3-15842) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/beta-Catenin-Antibody-9L6X0-Immunohistochemistry-Paraffin-NBP3-15842-img0002.jpg "Immunohistochemistry-Paraffin: beta-Catenin Antibody (9L6X0) [NBP3-15842] - Immunohistochemistry of paraffin-embedded Human cervical squamous cell carcinoma using [KO Validated] beta-Catenin Rabbit mAb (NBP3-15842) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: beta-Catenin Antibody (9L6X0) [NBP3-15842] - Immunohistochemistry of paraffin-embedded Human Invasive ductal carcinoma of breast using [KO Validated] beta-Catenin Rabbit mAb (NBP3-15842) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/beta-Catenin-Antibody-9L6X0-Immunohistochemistry-Paraffin-NBP3-15842-img0003.jpg "Immunohistochemistry-Paraffin: beta-Catenin Antibody (9L6X0) [NBP3-15842] - Immunohistochemistry of paraffin-embedded Human Invasive ductal carcinoma of breast using [KO Validated] beta-Catenin Rabbit mAb (NBP3-15842) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: beta-Catenin Antibody (9L6X0) [NBP3-15842] - Immunohistochemistry of paraffin-embedded human lung squamous carcinoma tissue using [KO Validated] beta-Catenin Rabbit mAb (NBP3-15842) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/beta-Catenin-Antibody-9L6X0-Immunohistochemistry-Paraffin-NBP3-15842-img0004.jpg "Immunohistochemistry-Paraffin: beta-Catenin Antibody (9L6X0) [NBP3-15842] - Immunohistochemistry of paraffin-embedded human lung squamous carcinoma tissue using [KO Validated] beta-Catenin Rabbit mAb (NBP3-15842) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Knockout Validated: beta-Catenin Antibody (9L6X0) [NBP3-15842] - Western blot analysis of extracts from normal (control) and beta-Catenin knockout (KO) 293T cells, using beta-Catenin antibody (NBP3-15842) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.](http://images.novusbio.com/fullsize/beta-Catenin-Antibody-9L6X0-Knockout-Validated-NBP3-15842-img0001.jpg "Knockout Validated: beta-Catenin Antibody (9L6X0) [NBP3-15842] - Western blot analysis of extracts from normal (control) and beta-Catenin knockout (KO) 293T cells, using beta-Catenin antibody (NBP3-15842) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.")
![Immunoprecipitation: beta-Catenin Antibody (9L6X0) [NBP3-15842] - Immunoprecipitation analysis of 600ug extracts of Mouse brain using 3ug beta-Catenin antibody (NBP3-15842). Western blot was performed from the immunoprecipitate using beta-Catenin (NBP3-15842) at a dilition of 1:1000.](http://images.novusbio.com/fullsize/beta-Catenin-Antibody-9L6X0-Immunoprecipitation-NBP3-15842-img0009.jpg "Immunoprecipitation: beta-Catenin Antibody (9L6X0) [NBP3-15842] - Immunoprecipitation analysis of 600ug extracts of Mouse brain using 3ug beta-Catenin antibody (NBP3-15842). Western blot was performed from the immunoprecipitate using beta-Catenin (NBP3-15842) at a dilition of 1:1000.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")