Azurocidin/CAP37/HBP Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: ALIHARFVMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDL |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
AZU1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, pH 7.2, 40% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for Azurocidin/CAP37/HBP Antibody
Background
Azurophil granules, specialized lysosomes of the neutrophil, contain at least 10 proteins implicated in the killing of microorganisms. The protein encoded by this gene is an azurophil granule antibiotic protein, with monocyte chemotactic and antibacterial activity. It is also an important multifunctional inflammatory mediator. This encoded protein is a member of the serine protease gene family but it is not a serine proteinase, because the active site serine and histidine residues are replaced. The genes encoding this protein, neutrophil elastase 2, and proteinase 3 are in a cluster located at chromosome 19pter. All 3 genes are expressed coordinately and their protein products are packaged together into azurophil granules during neutrophil differentiation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: ELISA
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Eq, Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Publications for Azurocidin/CAP37/HBP Antibody (NBP3-16991) (0)
There are no publications for Azurocidin/CAP37/HBP Antibody (NBP3-16991).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Azurocidin/CAP37/HBP Antibody (NBP3-16991) (0)
There are no reviews for Azurocidin/CAP37/HBP Antibody (NBP3-16991).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Azurocidin/CAP37/HBP Antibody (NBP3-16991) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Azurocidin/CAP37/HBP Products
Research Areas for Azurocidin/CAP37/HBP Antibody (NBP3-16991)
Find related products by research area.
|
Blogs on Azurocidin/CAP37/HBP