ATP6V0D1 Antibody (2G12) Summary
Immunogen |
ATP6V0D1 (NP_004682, 238 a.a. ~ 308 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLN |
Specificity |
ATP6V0D1 - ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 |
Isotype |
IgG1 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
ATP6V0D1 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Sandwich ELISA
- Western Blot 1:500
|
Application Notes |
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
Publications |
|
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for ATP6V0D1 Antibody (2G12)
Background
This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is known as the D subunit and is found ubiquitously.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu
Applications: Bind
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: Simple Western, WB
Species: Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Publications for ATP6V0D1 Antibody (H00009114-M01)(1)
Showing Publication 1 -
1 of 1.
Reviews for ATP6V0D1 Antibody (H00009114-M01) (0)
There are no reviews for ATP6V0D1 Antibody (H00009114-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ATP6V0D1 Antibody (H00009114-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ATP6V0D1 Products
Blogs on ATP6V0D1