![Western Blot: ATP2C1 Antibody (2G1) [H00027032-M01] - ATP2C1 monoclonal antibody (M01), clone 2G1 Analysis of ATP2C1 expression in HeLa.](http://images.novusbio.com/fullsize/ATP2C1-Antibody-2G1-Western-Blot-H00027032-M01-img0011.jpg "Western Blot: ATP2C1 Antibody (2G1) [H00027032-M01] - ATP2C1 monoclonal antibody (M01), clone 2G1 Analysis of ATP2C1 expression in HeLa.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IP, KD |
| Clone | 2G1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | ATP2C1 (AAH28139, 119 a.a. ~ 269 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQL |
| Specificity | ATP2C1 - ATPase, Ca++ transporting, type 2C, member 1 |
| Isotype | IgG1 Lambda |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | ATP2C1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, RNAi validation and ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for ATP2C1 Antibody (H00027032-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: ATP2C1 Antibody (2G1) [H00027032-M01] - Analysis of monoclonal antibody to ATP2C1 on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/ATP2C1-Antibody-2G1-Immunocytochemistry-Immunofluorescence-H00027032-M01-img0007.jpg "Immunocytochemistry/Immunofluorescence: ATP2C1 Antibody (2G1) [H00027032-M01] - Analysis of monoclonal antibody to ATP2C1 on HeLa cell. Antibody concentration 10 ug/ml.")
![Western Blot: ATP2C1 Antibody (2G1) [H00027032-M01] - Analysis of ATP2C1 over-expressed 293 cell line, cotransfected with ATP2C1 Validated Chimera RNAi ( Cat # H00027032-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ATP2C1 monoclonal antibody (M01), clone 2G1 (Cat # H00027032-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.](http://images.novusbio.com/fullsize/ATP2C1-Antibody-2G1-Western-Blot-H00027032-M01-img0009.jpg "Western Blot: ATP2C1 Antibody (2G1) [H00027032-M01] - Analysis of ATP2C1 over-expressed 293 cell line, cotransfected with ATP2C1 Validated Chimera RNAi ( Cat # H00027032-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ATP2C1 monoclonal antibody (M01), clone 2G1 (Cat # H00027032-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.")
![Western Blot: ATP2C1 Antibody (2G1) [H00027032-M01] - Analysis of ATP2C1 expression in transfected 293T cell line by ATP2C1 monoclonal antibody (M01), clone 2G1.Lane 1: ATP2C1 transfected lysate(100.6 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/ATP2C1-Antibody-2G1-Western-Blot-H00027032-M01-img0012.jpg "Western Blot: ATP2C1 Antibody (2G1) [H00027032-M01] - Analysis of ATP2C1 expression in transfected 293T cell line by ATP2C1 monoclonal antibody (M01), clone 2G1.Lane 1: ATP2C1 transfected lysate(100.6 KDa).Lane 2: Non-transfected lysate.")
![Immunoprecipitation: ATP2C1 Antibody (2G1) [H00027032-M01] - Analysis of ATP2C1 transfected lysate using anti-ATP2C1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ATP2C1 MaxPab rabbit polyclonal antibody.](http://images.novusbio.com/fullsize/ATP2C1-Antibody-2G1-Immunoprecipitation-H00027032-M01-img0008.jpg "Immunoprecipitation: ATP2C1 Antibody (2G1) [H00027032-M01] - Analysis of ATP2C1 transfected lysate using anti-ATP2C1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ATP2C1 MaxPab rabbit polyclonal antibody.")
![ELISA: ATP2C1 Antibody (2G1) [H00027032-M01] - Detection limit for recombinant GST tagged ATP2C1 is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/ATP2C1-Antibody-2G1-ELISA-H00027032-M01-img0013.jpg "ELISA: ATP2C1 Antibody (2G1) [H00027032-M01] - Detection limit for recombinant GST tagged ATP2C1 is approximately 0.03ng/ml as a capture antibody.")
![Western Blot Coagulation Factor VII Antibody [Unconjugated]](https://images.novusbio.com/images2/Coagulation_Factor_VII_AF2338_Immunocytochemistry__Immunofluorescence_17302.jpg)
![Immunocytochemistry Coagulation Factor VII Antibody [Unconjugated]](https://images.novusbio.com/images2/Coagulation_Factor_VII_AF2338_Immunocytochemistry__Immunofluorescence_17395.jpg)
![SDS-PAGE ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/ErbB2_1129-ER_70.jpg)
![Bioactivity ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/1129-er_recombinant-human-erbb2-her2-fc-chimera-protein-cf-bioactivity-7122020142841.jpg)
